Drugs Manufacturers and Suppliers
Buy Long Ester Trestolone Decanoate from info@goldenraws com Product Name Trestolone Decanoate Customized Customized Suitable for Elderly, Adult Purity >99% Molecular Formula C20H28O2 Molecular Weight 300.43512Assay 98% Appearance Light brown liquid Secification USP/BP Tags Trest
GoldenRaws [2017-11-17 17:50:35 ]
Buy Clomiphene Citrate Anti-Estrogen powder from info@goldenraws com Product Name Clomiphene Citrate Powder CAS No 50-41-9 Molecular formula C32H36ClNO8 Molecular weight 598.09 Appearance White power; Odourless. Assay 98% Delivery time 5-7 business days door-to-door Minimum order
GoldenRaws [2017-11-17 17:47:40 ]
Buy Methenolone Enanthate Primobolan Depot Powder from info@goldenraws com Product Name Methenolone Enanthate powder CAS 303-42-4 Molecular Weight 414.6206 Molecular Formula C27H42O3 Assay 99% Packing 1kg/foil bag EINECS 206-141-6 Appearance White or off-white powder Usage Methen
GoldenRaws [2017-11-17 17:32:14 ]
Buy Nandrolone Phenylpropionate NPP Powder from info@goldenraws com Product Name Nandrolone Phenylpropionate powder CAS No 62-90-8 Molecular formula C27H34O3 Molecular weight 406.56 Appearance White powder Assay 99%min Delivery time 5-7 working days door to door Minimum order 10g
GoldenRaws [2017-11-17 15:52:12 ]
Buy Nandrolone Decanoate Deca Durabolin Powder from info@goldenraws com Product Name Nandrolone Decanoate powder CAS No 360-70-3 Molecular formula C28H44O3 Molecular weight 428.65 Appearance light white powder, odourless. Refrigeration preservation Assay 99% min Delivery time 5-7
GoldenRaws [2017-11-17 15:51:07 ]
Buy LGD-3033 New Sarm Powder from info@goldenraws com Product Name LGD-3033 Powder CAS No 917891-35-1 Molecular Formula C16H14ClF3N2O Molecular Weight 342.743 Appearance Off-white fine powder Assay 98%+ Purity Supplier GoldenRaws Effective Dose 20mg split dose every 8-9 hours Sto
GoldenRaws [2017-11-17 15:48:36 ]
Product Description Rapamycin Synonyms 23,27-Epoxy-3H-pyrido[2,1-c][1,4]oxaazacyclohentriacontine; Sirolimus Molecular Formula C51H79NO13 Molecular Weight 914.18 CAS 53123-88-9 Application Rapamycin is a triene macrolide antibiotic, which demonstrates anti-fungal, anti-inflammato
Hunan World Well-Being Bio-tech Co.,Ltd. [2017-10-26 13:58:16 ]
Common names Deschloroketamine, DCK, DXE, O-PCM Substitutive name Deschloroketamine Systematic name 2-Phenyl-2-(methylamino)cyclohexanone Deschloroketamine, or 2-Phenyl-2-(methylamino)cyclohexanone, is classed as an arylcyclohexylamine Descholoroketamine is a chiral molecule a
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:56:09 ]
PubChem CID 3033985 Chemical Names Meclonazepam; UNII-RN43209SMA; 58662-84-3; RN43209SMA; Meclonazepamum; (3S)-5-(2-chlorophenyl)-3-methyl-7-nitro-1,3-dihydro-1,4-benzodiazepin-2-one Molecular Formula C16H12ClN3O3 Molecular Weight 329.74 g/mol InChI Key LMUVYJCAFWGNSY-VIFPVBQESA-
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:51:59 ]
Molecular Formula C10H14BrNO2 IUPAC Molar mass 260.13 g/mol 2C-B is a psychedelic drug. It was first synthesized by Alexander Shulgin in 1974. In Shulgin\'s book PiHKAL, the dosage range is listed as 12–24 mg. 2C-B is sold as a white powder sometimes pressed in tablets or gel
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:46:51 ]
A-PVP Synonyms A-pvp 2-(1-pyrrolidinyl)-Valerophenone O-2387 Formal Name 1-phenyl-2-(1-pyrrolidinyl)-1-pentanone, monohydrochloride CAS Number 5485-65-4 Molecular Formula C15H21NO • HCl Formula Weight 267.8 Formulation A crystalline solid We are a pro
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:45:57 ]
diclazepam Forma Name 7-chloro-5(2-chlorophenyl)-1,3-dihydro-1-methyl-2H-1,4-benzodiazepin-2-one CAS Number 2894-64-0 Synonyms 2 ’ -Chlorodiazepam Ro 5-3448 Molecular Formula C16H12CI2NN2O Formula Weight 319.2 purity ≥ 98% Formulation A crystalline solid SMILES CIC1=CC(C(C2=C
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:43:08 ]
alprazolam Formal Name 8-Chloro-1-methyl-6-phenyl-4H-[1,2,4]triazolo[4,3-a][1,4]benzodiazepine CAS Number 28981-97-7 Molecular Weight 308.8 Formulation A 1mg/ml solution in methanol SMILES IC1=CC(C(C2=CC=CC=C2)=NC3)=C(C=C1)N4C3=NN=C4C InChI Code InChI=1S/C17H13CIN4/c1-11-20-21-16
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:41:36 ]
etizolam Bioavailability 93% Molar mass 342.07g/mol CAS ID 40054-69-1 Biological half-life 6.2 hours(main metabolite is 8.2 hours) Metabolism Hepatic Formula C17H15ClN4S We are a professional supplier of alprazolam, etizolam, diclazepam, hydrocodone, clonazolam, a-pvp, 2c-b, 3-Me
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:40:11 ]
3-MeO-PCP CAS 91164-58-8 Formula C18H27NO Molecular Weight 273.41 Compound purity>99.7% Appearance power IUPAC 1-[1-(3-methoxyphenyl)cyclohexyl]-piperidine Synonyms 3-Methoxyphencyclidine We are a professional supplier of alprazolam, etizolam, diclazepam, hydrocodone, clonazolam,
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:38:44 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We provi
Creative Peptides [2017-10-16 14:12:46 ]
CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on
Creative Peptides [2017-10-16 14:12:09 ]
Kigtropin HGH Supplies for Health Providers (Boxes,Vials,Labels). Box Kingtropin Vials Glass Stickers 100 Labels per sheet Other supplies available Hygetropin, Riptropin, Taitropin, Ansomone, Haratropin, Igtropin
The HGH and HCG Company [2017-09-25 22:54:53 ]
OSTARINE (MK-2866) Synonyms ( S)-N-(4-cyano-3-(trifluoromethyl)phenyl)-3-(4-cyanophenoxy)-2-hydroxy-2-methylpropanamide CAS NO 1032350-13-2 Molecular Formula C19H14F3N3O3 Molecular weight 480.39 Appearance Powder Detail Enobosarm, also known as ostarine, is an investigational se
Wuhan Fantaike pharmaceutical Technology Co., Ltd. [2017-09-13 15:23:39 ]
This gene encodes a leucine-rich transmembrane glycoprotein that may be involved in cell adhesion. The encoded protein is an oncofetal antigen that is specific to trophoblast cells. In adults this protein is highly expressed in many tumor cells and is associated with poor clinica
Creative Biolabs [2017-08-31 11:32:48 ]
