Drugs Manufacturers and Suppliers

Total 2038 products found
Eptifibatide

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Eptifibatide Sequence Mpr-Har-Gly-Asp-Trp-Pro-Cys-NH2 Cas No. 148031-34-9 Molecular Formula C35H49N11O9S2 Molecular Weight 832.4 Specific Rotation[20/D] -75.0~-95.0°(C=1,1%HAc) Amin

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:26:11 ]

Follistatin 344

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Follistatin hghsalehumanstech(at)gmail dot com 295,315,317,344 amino acids of the protein. FST(Recombinant Human Follistatin) Period in infants and children, continued growth of muscle, hard

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:20:24 ]

Triptorelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Triptorelin introductions Appearance White powder Solubility Soluble in water or 1% acetic acid at a concentration of 1mg/ml to give a clear, colorless solution Identity by HPLC The retentio

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:04:51 ]

HGH Fragment (176-191)

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Growth Hormone peptide fragment 176-191, also known as HGH Frag 176-191, is a modified form of amino acids 176-191 of the GH polypeptide. Investigators at Monash University discovered that t

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:02:01 ]

Pentadecapeptide BPC 157

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com pentadecapeptide BPC 157 Alias Booly Protection Compound 15, Pentadecapeptide, BPC 157 CAS 137525-51-0 Sequence Gly-Glu-Pro-Pro-Pro-Gly- Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val MF C62H98N16O22 M

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:00:49 ]

Oxytocin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Formula C43H66N12O12S2 Synonyms 3-Isoleucine-8-leucine vasopressin;Alpha-hypophamine;Atonin O;Di-sipidin;Endopituitrina;Hyphotocin;Intertocine S;Nobitocin S;Orasthin;Partocon;Perlacton;Pitoc

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:58:55 ]

Sermorelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-G

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:58:01 ]

Hexarelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Hexarelin Synonyms HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE RELEASING HEXAPEPTIDE;Examorelin;Hexareline;L-Histidyl-2-methyl

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:55:45 ]

Ipamorelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Ipamorelin Sequence Aib-His-D-2-Nal-D-Phe-Lys-NH2 Cas No. 170851-70-4 Purity (HPLC) 98.0% Molecular Formula C38H49N905 Molecular Weight 712.03 Single Impurity (HPLC) 0.5%max Amino Acid Compo

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:54:53 ]

Melanotan 2

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com MT-2 Product Name Melanotan II, MT- II split into vivals, MT2 supplier, Melanotan II manufacturer MT2 Another Name Melanotan II; AC-NLE-CYCLO(-BETA-ASP-HIS-D-PHE-ARG-TRP-EPSILON-LYS-NH2); Me

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:35:57 ]

CJC-1295

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com CJC-1295 Alias CJC-1295 Acetate; CJC1295(Without DAC); Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys (Mal

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:28:33 ]

CJC-1295 DAC

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com CJC-1295 DAC (Drug Affinity Complex) Alias CJC1295(GHRH/DAC) Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Ly

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:27:44 ]

Articaine Hydrochloride

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Articaine hydrochloride Alias Articaine HCl CAS 23964-57-0 EINECS 245-957-7 M F. C13H20N2O3S ClH M W. 320.839 M S. Usage:Anesthetic;Na+ channel inhibitor. Articaine hydrochloride Alias A

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 10:17:34 ]

Nandrolone laurate

Nandrolone laurate Email angel(at)health-gym(dot)com Skype live angel_11616 CAS 26490-31-3 EIENCS 247-739-7 MF C30H48O3 MW 456.7 Assay 99% min. Packing foil bag or tin. Delivery Express courier. Usage pharmaceutical material, Tibolone intermediate. Standard Enterprise standard Do

HK Globle Sino Ocean Dev. Co., Limited      [2016-12-10 09:28:37 ]

Nandrolone cypionate

Nandrolone cypionate Email angel(at)health-gym(dot)com Skype live angel_11616 CAS 601-63-8 EIENCS 210-006-7 MF C26H38O3 MW 398.57812 Specification 200mg/ml Packing 1kg net/ plastic bottle or tin.. Standard Enterprise standard Delivery Express courier. Appearance yellow liquids Us

HK Globle Sino Ocean Dev. Co., Limited      [2016-12-10 09:26:43 ]

Dehydronandrolon acetate

Dehydronandrolon acetate Email angel(at)health-gym(dot)com Skype live angel_11616 Other name Dehydronandrolon; Dehydronandrolone-6 Acetate; 6-Dehydronandrolone acetate CAS 2590-41-2 Molecular formula C20H26O3 Molecular weight 314.42 Assay 98% Storage Controlled Substance, -20ºCF

HK Globle Sino Ocean Dev. Co., Limited      [2016-12-10 09:25:57 ]

Mestanolone

Mestanolone Email angel(at)health-gym(dot)com Skype live angel_11616 CAS NO. 521-11-9 EINECS 208-302-6 Assay 99% Molecular Formula C20H32O2 Molecular Weight 304.47 Melting point 224-226°C Packing 1kg/tin/foil bag Appearance White or Similar crystalline powder Soluble in acetone,

HK Globle Sino Ocean Dev. Co., Limited      [2016-12-10 09:17:28 ]

Methyltestosterone (17-Alpha-Methyl-Testosterone)

Methyltestosterone (17-Alpha-Methyl-Testosterone) Email angel(at)health-gym(dot)com Skype live angel_11616 CAS 65-04-3 EINECS 200-366-3 Assay 99% min. Grade Pharmaceutical Grade Delivery time within 12 hours upon receipt of payment Delivery EMS, DHL, TNT, FedEx, UPS Delivery sa

HK Globle Sino Ocean Dev. Co., Limited      [2016-12-10 09:13:22 ]

Testosterone propionate

Testosterone propionate Email angel(at)health-gym(dot)com Skype live angel_11616 CAS 57-85-2 EINECS 200-351-1 Assay 98% min. Molecular Formula C22H32O3 Molecular weight 344.49 Packing diversiform Character White crystalline powder. Delivery safe & timely, around 5-7 business days

HK Globle Sino Ocean Dev. Co., Limited      [2016-12-10 09:10:12 ]

Procaine

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Synonyms 2-(Diethylamino)ethyl p-aminobenzoate;2-(diethylamino)ethylp-aminobenzoate;2-diethylaminoethyl4-aminobenzoate;2-Diethylaminoethylester kyseliny p-aminobenzoove CAS 59-46-1 Appearanc

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-09 16:14:53 ]