GLP-2 (rat)

Minimum Order
1
Packaging
N/A
Delivery
15 Days
CAS No.
195262-56-7
Sequence
HADGSFSDEMNTILDNLATRDFINWLIQTKITD
M.W/Mr.
3796.17
Molecular Formula
C166H256N44O56S
Application
Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on gastrointestinal function including regulation of intestinal glucose transport, food intake, and gastric acid secretion.
Storage
-20°C



Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We provide GLP-2 (rat). Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on gastrointestinal function including regulation of intestinal glucose transport, food intake, and gastric acid secretion.More information please visit our website: https://www.creative-peptides.com/product/glp-rat-item-r0838-34640.html

  • Country: United States
  • Business Type: Manufacturer
  • Market:Americas,Asia,Europe,European Union,Oceania
  • Founded Year:2005
  • Address:45-16 Ramsey Road, Shirley, New York 11967
  • Contact:Cathy Miller
more images of GLP-2 (rat)
*Your name:
*Your Email:
*To:Creative Peptides
*Subject:
*Message:
Enter between 20 to 3,000 characters. English only.     Characters : 0 / 3000
*Enter the secure code shown below Mfrbee security Image      Reload Image

submiting now We do inquire for you , please wait ...

Rat Complement  With Diluent
Rat Complement With Diluent

This product is a Complement Serum freshly prepared from Rat whole blood in cold and then frozen at -80°C to prevent degradation of complement activity. It can be used in the hemolytic plaque assays, complement fixation assays, and other lymphocytotoxicity and hemolytic ...

Creative Biolabs

Rat Wistar Hanover Complement Serum
Rat Wistar Hanover Complement Serum

This product is a Complement Serum freshly prepared from Rat whole blood in cold and then frozen at -80°C to prevent degradation of complement activity. It can be used in the hemolytic plaque assays, complement fixation assays, and other lymphocytotoxicity and hemolytic ...

Creative Biolabs

Rat Wistar Complement Serum
Rat Wistar Complement Serum

This product is a Complement Serum freshly prepared from Rat whole blood in cold and then frozen at -80°C to prevent degradation of complement activity. It can be used in the hemolytic plaque assays, complement fixation assays, and other lymphocytotoxicity and hemolytic ...

Creative Biolabs

Rat Sprague Dawley Complement Serum
Rat Sprague Dawley Complement Serum

This product is a Complement Serum freshly prepared from Rat whole blood in cold and then frozen at -80°C to prevent degradation of complement activity. It can be used in the hemolytic plaque assays, complement fixation assays, and other lymphocytotoxicity and hemolytic ...

Creative Biolabs

Rat Complement Serum
Rat Complement Serum

This product is a Complement Serum freshly prepared from Rat whole blood in cold and then frozen at -80°C to prevent degradation of complement activity. It can be used in the hemolytic plaque assays, complement fixation assays, and other lymphocytotoxicity and hemolytic ...

Creative Biolabs

FY-ER3605 Rat Bax(Apoptosis regulator BAX) ELISA Kit
FY-ER3605 Rat Bax(Apoptosis regulator BAX) ELISA Kit

Rat Bax(Apoptosis regulator BAX) ELISA Kit Basic Information Product Name Rat Bax(Apoptosis regulator BAX) ELISA Kit Catalog NO. FY-ER3605 Alias Bax ELISA Kit, apoptosis regulator BAX ELISA Kit, BCL2-associated X protein ELISA Kit, Bcl2-L-4 ELISA Kit, BCL2L4bcl2-L-4 ELISA Kit, ...

Wuhan Feiyue Biotechnology Co., LTD.,

FY-ER4801 Rat Salmonella-typ antibody(Salmonella Ab) ELISA kit
FY-ER4801 Rat Salmonella-typ antibody(Salmonella Ab) ELISA kit

Rat Salmonella-typ antibody(Salmonella Ab) ELISA Kit Product Name Rat Salmonella-typ antibody(Salmonella Ab) ELISA kit Catalog NO. FY-ER4801 Size 48T, 96T Storage 2-8 ℃ for 6 months Species Rat CV %() Intra-Assay: CV<8% Inter-Assay: CV<10% Note For Research Use Only ...

Wuhan Feiyue Biotechnology Co., LTD.,

FY-ER3503 Rat 4-HNE(4-Hydroxynonenal) ELISA Kit
FY-ER3503 Rat 4-HNE(4-Hydroxynonenal) ELISA Kit

Rat 4-HNE(4-Hydroxynonenal) ELISA Kit Basic Information Product Name Rat 4-HNE(4-Hydroxynonenal) ELISA Kit Catalog NO. FY-ER3503 Alias 4-HNE ELISA Kit, 4-Hydroxynonenal ELISA Kit, HNE ELISA Kit, 4 HNE ELISA Kit Detection Method Competitive ELISA, Coated with Antigen Size 48T, ...

Wuhan Feiyue Biotechnology Co., LTD.,

Rat Lipase, Hormone Sensitive (LIPE) ELISA kit
Rat Lipase, Hormone Sensitive (LIPE) ELISA kit

Catalog NO. FY-ER7976 Sensitivity 0.07 ng/mL Detection range 0.156-10ng/mL Market Price ($) Please contact us for better price Rat Lipase, Hormone Sensitive (LIPE) ELISA kit Basic Information Product Name Rat Lipase, Hormone Sensitive (LIPE) ELISA kit Catalog NO. FY-ER7976 ...

Wuhan Feiyue Bio

Rat Alkaline Phosphatase, Intestinal (ALPI) ELISA kit
Rat Alkaline Phosphatase, Intestinal (ALPI) ELISA kit

Catalog NO. FY-ER7994 Sensitivity 0.39 ng/mL Detection range 0.781-50ng/mL Market Price ($) Please contact us for better price Rat Alkaline Phosphatase, Intestinal (ALPI) ELISA kit Basic Information Product Name Rat Alkaline Phosphatase, Intestinal (ALPI) ELISA kit Catalog NO. ...

Wuhan Feiyue Bio