Drugs Manufacturers and Suppliers

Total 2427 products found
Factory supply Rapamycin/sirolimus 98%/Ginkgo biloba extract/Anti-biotic

Product Description Rapamycin Synonyms 23,27-Epoxy-3H-pyrido[2,1-c][1,4]oxaazacyclohentriacontine; Sirolimus Molecular Formula C51H79NO13 Molecular Weight 914.18 CAS 53123-88-9 Application Rapamycin is a triene macrolide antibiotic, which demonstrates anti-fungal, anti-inflammato

Hunan World Well-Being Bio-tech Co.,Ltd.      [2017-10-26 13:58:16 ]

2-Oxo-PCM from China E-mail: rita@tkbiotechnology.com

Common names Deschloroketamine, DCK, DXE, O-PCM Substitutive name Deschloroketamine Systematic name 2-Phenyl-2-(methylamino)cyclohexanone Deschloroketamine, or 2-Phenyl-2-(methylamino)cyclohexanone, is classed as an arylcyclohexylamine Descholoroketamine is a chiral molecule a

Wuhan Tuoke Biotechnology Co.,Ltd      [2017-10-18 13:56:09 ]

meclonazepam from China E-mail: rita@tkbiotechnology.com

PubChem CID 3033985 Chemical Names Meclonazepam; UNII-RN43209SMA; 58662-84-3; RN43209SMA; Meclonazepamum; (3S)-5-(2-chlorophenyl)-3-methyl-7-nitro-1,3-dihydro-1,4-benzodiazepin-2-one Molecular Formula C16H12ClN3O3 Molecular Weight 329.74 g/mol InChI Key LMUVYJCAFWGNSY-VIFPVBQESA-

Wuhan Tuoke Biotechnology Co.,Ltd      [2017-10-18 13:51:59 ]

2c-b from China E-mail: rita@tkbiotechnology.com

Molecular Formula C10H14BrNO2 IUPAC Molar mass 260.13 g/mol 2C-B is a psychedelic drug. It was first synthesized by Alexander Shulgin in 1974. In Shulgin\'s book PiHKAL, the dosage range is listed as 12–24 mg. 2C-B is sold as a white powder sometimes pressed in tablets or gel

Wuhan Tuoke Biotechnology Co.,Ltd      [2017-10-18 13:46:51 ]

A-PVP from China E-mail: rita@tkbiotechnology.com

A-PVP Synonyms A-pvp 2-(1-pyrrolidinyl)-Valerophenone O-2387 Formal Name 1-​phenyl-​2-​(1-​pyrrolidinyl)-​1-​pentanone,​ monohydrochloride CAS Number 5485-65-4 Molecular Formula C15H21NO • HCl Formula Weight 267.8 Formulation A crystalline solid We are a pro

Wuhan Tuoke Biotechnology Co.,Ltd      [2017-10-18 13:45:57 ]

diclazepam from China E-mail: rita@tkbiotechnology.com

diclazepam Forma Name 7-chloro-5(2-chlorophenyl)-1,3-dihydro-1-methyl-2H-1,4-benzodiazepin-2-one CAS Number 2894-64-0 Synonyms 2 ’ -Chlorodiazepam Ro 5-3448 Molecular Formula C16H12CI2NN2O Formula Weight 319.2 purity ≥ 98% Formulation A crystalline solid SMILES CIC1=CC(C(C2=C

Wuhan Tuoke Biotechnology Co.,Ltd      [2017-10-18 13:43:08 ]

alprazolam from China E-mail: rita@tkbiotechnology.com

alprazolam Formal Name 8-Chloro-1-methyl-6-phenyl-4H-[1,2,4]triazolo[4,3-a][1,4]benzodiazepine CAS Number 28981-97-7 Molecular Weight 308.8 Formulation A 1mg/ml solution in methanol SMILES IC1=CC(C(C2=CC=CC=C2)=NC3)=C(C=C1)N4C3=NN=C4C InChI Code InChI=1S/C17H13CIN4/c1-11-20-21-16

Wuhan Tuoke Biotechnology Co.,Ltd      [2017-10-18 13:41:36 ]

etizolam from China E-mail: rita@tkbiotechnology.com

etizolam Bioavailability 93% Molar mass 342.07g/mol CAS ID 40054-69-1 Biological half-life 6.2 hours(main metabolite is 8.2 hours) Metabolism Hepatic Formula C17H15ClN4S We are a professional supplier of alprazolam, etizolam, diclazepam, hydrocodone, clonazolam, a-pvp, 2c-b, 3-Me

Wuhan Tuoke Biotechnology Co.,Ltd      [2017-10-18 13:40:11 ]

3-MeO-PCP from China E-mail: rita@tkbiotechnology.com

3-MeO-PCP CAS 91164-58-8 Formula C18H27NO Molecular Weight 273.41 Compound purity>99.7% Appearance power IUPAC 1-[1-(3-methoxyphenyl)cyclohexyl]-piperidine Synonyms 3-Methoxyphencyclidine We are a professional supplier of alprazolam, etizolam, diclazepam, hydrocodone, clonazolam,

Wuhan Tuoke Biotechnology Co.,Ltd      [2017-10-18 13:38:44 ]

Motilin (human, porcine)

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We provi

Creative Peptides      [2017-10-16 14:12:46 ]

GLP-2 (rat)

CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on

Creative Peptides      [2017-10-16 14:12:09 ]

APETx2

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ht

Creative Peptides      [2017-09-28 16:34:38 ]

Kigtropin HGH Supplies for Health Providers (Boxes,Vials,Labels)

Kigtropin HGH Supplies for Health Providers (Boxes,Vials,Labels). Box Kingtropin Vials Glass Stickers 100 Labels per sheet Other supplies available Hygetropin, Riptropin, Taitropin, Ansomone, Haratropin, Igtropin

The HGH and HCG Company      [2017-09-25 22:54:53 ]

Enobosarm

OSTARINE (MK-2866) Synonyms ( S)-N-(4-cyano-3-(trifluoromethyl)phenyl)-3-(4-cyanophenoxy)-2-hydroxy-2-methylpropanamide CAS NO 1032350-13-2 Molecular Formula C19H14F3N3O3 Molecular weight 480.39 Appearance Powder Detail Enobosarm, also known as ostarine, is an investigational se

Wuhan Fantaike pharmaceutical Technology Co., Ltd.      [2017-09-13 15:23:39 ]

Bispecific TPBG/CD3 antibody

This gene encodes a leucine-rich transmembrane glycoprotein that may be involved in cell adhesion. The encoded protein is an oncofetal antigen that is specific to trophoblast cells. In adults this protein is highly expressed in many tumor cells and is associated with poor clinica

Creative Biolabs      [2017-08-31 11:32:48 ]

Bispecific CSPG4/CD3 antibody

A human melanoma-associated chondroitin sulfate proteoglycan plays a role in stabilizing cell-substratum interactions during early events of melanoma cell spreading on endothelial basement membranes. CSPG4 represents an integral membrane chondroitin sulfate proteoglycan expressed

Creative Biolabs      [2017-08-31 11:15:39 ]

Bispecific GPC3/CD3 antibody

Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytopla

Creative Biolabs      [2017-08-31 11:14:57 ]

Bispecific FAP/CD3E antibody

The protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant cells of bone and soft ti

Creative Biolabs      [2017-08-31 11:14:12 ]

New Product MK-677

Product Name MK-677 CAS NO 159752-10-0 Molecular Formula C27H36N4O5S CH4O3S Molecular weight 624.776 Appearance Powder Detail MK-677 also known as Ibutamoren, MK-0677, L-163,191 is a non-peptidic, potent, long-acting, orally-active, and selective agonist of the ghrelin receptor a

Wuhan Fantaike pharmaceutical Technology Co., Ltd.      [2017-08-29 10:10:33 ]

sell 3cmc 4cmc 4-cmc 3-cmc 4-Chloromethcathinone Clephedrone polish

4CMC(4-Chloromethcathinone) Formula C10H12ClNO Cas 1225843-86-6 Appearance bIg crystals Skype tom13drugs sales(at)luchibiology com 4-Chloromethcathinone (also known as 4-CMC and Clephedrone) is a stimulant drug of the cathinone class that has been sold online as a designer drug

Neimenggu Luchi Biotechnology Co.,Ltd      [2017-08-17 13:33:17 ]