Searching h , total 108822 products,queries done in 15 ms

Oxytocin, 2mg/vial

Oxytocin, 2mg/vial CAS 50-56-6 synonyms oxytocin lyophilized; oxytocin acetate; H-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2 Disulfide bond; EINECS 200-048-4 MF C43H66N12O12S2 MW 1007.19 Grade Standard Medicine Grade Appearance White powder Oxytocin is a cyclic polypeptide with all

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:23:41 ]

Sermorelin, 2mg/vial

Sermorelin, 2mg/vial Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-AR

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:23:18 ]

GHRP-6, 5mg/vial, 10mg/vial

GHRP-6, 5mg/vial, 10mg/vial Product Name Growth hormone releasing peptide Synonyms sk&f110679;[D-TRP7, ALA8, D-PHE10]-ALPHA-MELANOCYTE STIMULATING HORMONE (6-11) AMIDE;[D-TRP7,ALA8,D-PHE10]-ALPHA-MELANOCYTE STIMULATING HORMONE FRAGMENT 6-11 AMIDE;(D-TRP7,ALA8,D-PHE10)-ALPHA-MSH (

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:22:04 ]

PT-141,Bremelanotide, 10mg/vial

PT-141,Bremelanotide, 10mg/vial Molecular Formula C50H68N14O10 Molecular Weight 1025.16 CAS NO 189691-06-3 Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 1.Appearance White powder White powder 2 Solubility Soluble in water and 1% acetic acid Conforms 3 Specifical Optical Rotation

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:19:05 ]

Brushless alternators

The alternator has the following features 1. +- 1.0 % Voltage regulation (max.) in static conditions 2. IP 22 protection with insulation class H 3. Permissible overload of 10% for one hour in 12 hours of operation. The alternator/generators have been designed for use in a maximum

Jiangsu Farrand Alternator      [2015-10-28 14:01:41 ]

Roland VersaCAMM VP-300i Printer/Cutter

Site wahanahash com Accept Paypal The VersaCAMM Series is highly versatile for an endless range of applications. With just one device, you can produce decals, labels, stickers, posters, POP, vehicle wraps, heat transfers for apparel decoration and other promotional items of any

Wahanahash      [2015-10-27 19:58:01 ]

Roland SOLJET PRO III XJ-540 54-inch Printer

Site wahanahash com Accept Paypal The SOLJET PRO III XJ series of large-format digital printers is offered in 54,” 64” and 74” models, combining high-speed performance and superior image quality for the ultimate in six-color digital printing. Numerous upgrades make the XJ

Wahanahash      [2015-10-27 19:56:14 ]

Mimaki JV5-320S Printer (128-inch)

Site wahanahash com Accept Paypal The JV5-320S a New lineup, super-jumbo size of 3,250mm (128"), for "Exquisitely beautiful, super high-speed performance" JV5-320S. As time-consuming and costly welding is not needed, JV5-320S makes it ideal for both immediate delivery and high-v

Wahanahash      [2015-10-27 19:53:12 ]

Roland VersaCAMM VS-540

Site wahanahash com Accept Paypal The VersaCAMM VS-540, VS-420 and VS-300 are printers/cutters that feature up to eight colours, including metallic silver and white. When you combine the metallic ink with CMYK, you can create over 500 metallic colours. These colours give your pr

Wahanahash      [2015-10-27 19:52:04 ]

Summa S75

Site wahanahash com Accept Paypal Summa S75 The versatile new 30-inch Summa S75 T Series gives you Summa S Class power and precision with a state-of-the-art TrueTangential™ cutting head. It employs our most powerful servomotors yet and Summa's MicroSprocket™ drive to let you

Wahanahash      [2015-10-27 19:50:54 ]

Roland Hi-Fi JET Pro II FJ-540 54-inch Printer

Site wahanahash com Accept Paypal The Hi-Fi JET Pro II offers the best digital print quality in the industry. Thanks to variable droplet technology, 1440x1440 dpi resolution and precise media movement, this wide format inkjet printer is ideal for producing fine art reproductions

Wahanahash      [2015-10-27 19:47:15 ]

Graphtec CE5000-120

Site wahanahash com Accept Paypal The CE5000-120 (48") delivers a maximum cutting force of 450 grams and a maximum speed of 40 inches per second (45 degree angle.) and provides a 39-step range up to 450g cutting force. The built-in front control panel provides complete parameter

Wahanahash      [2015-10-27 19:41:20 ]

Mimaki JV5-160S Printer (63-inch)

Site wahanahash com Accept Paypal Mimaki has responded to the needs of power users and quick delivery, introducing the next generation of high speed-high quality wide format solvent inkjet printers. The JV5-160S are the next generation solvent inkjet printers equipped with newly

Wahanahash      [2015-10-27 19:40:14 ]

Roland GX-640 CAMM-1 Pro

Site wahanahash com Accept Paypal Power and Precision Equipped with the industry’s most powerful cutting motors , the GX-640 is ideal for long, uninterrupted production runs and years of reliable service for your business. In fact, GX-640 servo motors are the same motors that

Wahanahash      [2015-10-27 19:36:32 ]

Graphtec FC8000-75

Site wahanahash com Accept Paypal The new FC8000 series is available in five model sizes FC8000-60 24", FC8000-75 30”, the FC8000-100 42”, the FC8000-130 54”, the FC8000-160. Maximum compatible media widths for each model are 30.3”, 36”, 48”, 60”, and 72” respect

Wahanahash      [2015-10-27 19:35:23 ]

H-263 Best price Wireless Gaming keyboard SC-MD-KG402

Model SC-MD-KG402 Type Gaming keyboard Connection type Wired Interface USB Cable length 1.8M Battery none Button NO. 104 keys Size 434*138*33.5mm Weight 990g Color black MOQ 3000PCS Overprint logo can Featuresa; * With iron plate. * Optional with light. * Version available UK, US

塞维斯数码产品有限公司      [2015-10-27 16:13:34 ]

high chrome blow bar impact crusher spare parts

Type Crusher Hammer Machine Type Impact Crusher Certification ISO Material High Manganese Steel Processing Type Casting Use Ore Mining Feature Long using time Usage Mining, smelting, building H T Water Toughening Color As customers' requires Product Property Durable and Stable

crushersparewearparts      [2015-10-27 14:37:12 ]

shanbao SBM high manganese steel jaw plate crusher spare parts

Type Jaw Plate Machine Type Crusher, Jaw Crusher Certification ISO Material High Manganese Steel Processing Type Casting, Casting Jaw Plate Use Ore Mining Feature Long using time Usage Mining, smelting, building H T Water Toughening Color As customers' requires Product Property D

crushersparewearparts      [2015-10-27 14:34:09 ]

high chrome impact crusher blow bar

Type hammer plate Machine Type Impact Crusher Certification ISO Material High Manganese Steel Processing Type Casting Blow Bar Use Ore Mining Feature Long using time Usage Mining, smelting, building H T Water Toughening Color As customers' requires Product Property Durable and St

crushersparewearparts      [2015-10-27 14:30:27 ]

high manganese steel casting jaw plate

Type Jaw Plate Machine Type Crusher, Jaw Crusher Certification ISO Material High Manganese Steel Processing Type Casting, Casting Jaw Plate Use Ore Mining Feature Long using time Usage Mining, smelting, building H T Water Toughening Color As customers' requires Product Property D

crushersparewearparts      [2015-10-27 14:27:48 ]