Searching h , total 108828 products,queries done in 12 ms
High Quality Steroid Powder Trenbolone Acetate For Muscle Gain

Trenbolone Acetate English Synonyms 17-(acetyloxy)-(17-beta)-estra-11-trien-3-one;17-beta-acetoxy-delta-4,9,11-estratrien-3-one;17-beta-hydroxyestra-4,9,11-trien-3-oneacetate;9,11-trien-3-one,17-beta-hydroxy-estra-acetate;finaplix;ru1697;trienboloneacetate;revalor-h CAS NO. 10161

Zhuhai Shuangbojie Technology Co.,Ltd      [2015-10-30 20:45:04 ]

W8-KM512I-30PL-4H

Model W8 -KM512I-30PL-4H Printing Quality 360dpi Printing Speed Draft Mode 480X360dpi 2pass @ 120sqm/h Production Mode 480X540dpi 3pass @ 90sqm/h Quality Mode 480X720dpi 4pass @ 60sqm/h Model W8 -KM512I-30PL-8H Printing Quality 360dpi Printing Speed Draft Mode 480X360dpi 2pass @

WinJET      [2015-10-30 16:07:40 ]

4 port 24m with12dBi uhf rfid reader

HYR830 adopts Impinj R2000 module, maximum power output is 31dbm. 4 RP TNC ports, with an 12dbi circular polarized antenna, reading distance can reach 24 meters. Reading speed is 400 tags/sec. Support LBT function. Support dense reader working mode(DRM) 8 LED lights, real-time di

联云星      [2015-10-30 15:49:46 ]

Stanozolol / Winstrol

Stanozolol, Winstrol 99% Anabolic Stanozolol (CAS 10418-03-8) 99% Purity Stanozolol Coarse Winstrol Raw Powder Steroid Product Name Stanozolol Synonyms STANOZOL;STANOZOLOL;STANAZOL;winstrol l;1,10a,12a-Trimethyl-1,2,3,3a,3b,4,5,5a,6,8,10,10a,10b,11,12,12a-hexadecahydrocyclopenta[

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:52:00 ]

Trenbolone Acetate

Trenbolone Acetate Anabolice Steroid Hormone Trenbolone Acetate with Safe Shipping Trenbolone Acetate 99% Min Finaplix Trenbolone Acetate Product Name Revalor-H Synonyms 17-(acetyloxy)-(17-beta)-estra-11-trien-3-one;17-beta-acetoxy-delta-4,9,11-estratrien-3-one;17-beta-hydroxyest

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:42:27 ]

Benzocaine

Benzocaine Synonyms Aethoform;4-aminobenzoic acid ethyl ester;Labotest-bb ltbb000527;H-4-abz-oet;Ethyl 4-aminobenzoate;Ethyl p-aminobenzoate CAS 94-09-7 MF C9H11NO2 MW 165.19 EINECS 202-303-5 HS code 29224999.90 Product Categories Aromatic Esters;C8 to C9;Carbonyl Compounds;Ester

Zhuhai Shuangbojie Technology Co.,Ltd      [2015-10-30 14:35:44 ]

Oxytocin, 2mg/vial

Oxytocin, 2mg/vial CAS 50-56-6 synonyms oxytocin lyophilized; oxytocin acetate; H-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2 Disulfide bond; EINECS 200-048-4 MF C43H66N12O12S2 MW 1007.19 Grade Standard Medicine Grade Appearance White powder Oxytocin is a cyclic polypeptide with all

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:23:41 ]

Sermorelin, 2mg/vial

Sermorelin, 2mg/vial Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-AR

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:23:18 ]

GHRP-6, 5mg/vial, 10mg/vial

GHRP-6, 5mg/vial, 10mg/vial Product Name Growth hormone releasing peptide Synonyms sk&f110679;[D-TRP7, ALA8, D-PHE10]-ALPHA-MELANOCYTE STIMULATING HORMONE (6-11) AMIDE;[D-TRP7,ALA8,D-PHE10]-ALPHA-MELANOCYTE STIMULATING HORMONE FRAGMENT 6-11 AMIDE;(D-TRP7,ALA8,D-PHE10)-ALPHA-MSH (

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:22:04 ]

PT-141,Bremelanotide, 10mg/vial

PT-141,Bremelanotide, 10mg/vial Molecular Formula C50H68N14O10 Molecular Weight 1025.16 CAS NO 189691-06-3 Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 1.Appearance White powder White powder 2 Solubility Soluble in water and 1% acetic acid Conforms 3 Specifical Optical Rotation

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:19:05 ]

Brushless alternators

The alternator has the following features 1. +- 1.0 % Voltage regulation (max.) in static conditions 2. IP 22 protection with insulation class H 3. Permissible overload of 10% for one hour in 12 hours of operation. The alternator/generators have been designed for use in a maximum

Jiangsu Farrand Alternator      [2015-10-28 14:01:41 ]

Roland VersaCAMM VP-300i Printer/Cutter

Site wahanahash com Accept Paypal The VersaCAMM Series is highly versatile for an endless range of applications. With just one device, you can produce decals, labels, stickers, posters, POP, vehicle wraps, heat transfers for apparel decoration and other promotional items of any

Wahanahash      [2015-10-27 19:58:01 ]

Roland SOLJET PRO III XJ-540 54-inch Printer

Site wahanahash com Accept Paypal The SOLJET PRO III XJ series of large-format digital printers is offered in 54,” 64” and 74” models, combining high-speed performance and superior image quality for the ultimate in six-color digital printing. Numerous upgrades make the XJ

Wahanahash      [2015-10-27 19:56:14 ]

Mimaki JV5-320S Printer (128-inch)

Site wahanahash com Accept Paypal The JV5-320S a New lineup, super-jumbo size of 3,250mm (128"), for "Exquisitely beautiful, super high-speed performance" JV5-320S. As time-consuming and costly welding is not needed, JV5-320S makes it ideal for both immediate delivery and high-v

Wahanahash      [2015-10-27 19:53:12 ]

Roland VersaCAMM VS-540

Site wahanahash com Accept Paypal The VersaCAMM VS-540, VS-420 and VS-300 are printers/cutters that feature up to eight colours, including metallic silver and white. When you combine the metallic ink with CMYK, you can create over 500 metallic colours. These colours give your pr

Wahanahash      [2015-10-27 19:52:04 ]

Summa S75

Site wahanahash com Accept Paypal Summa S75 The versatile new 30-inch Summa S75 T Series gives you Summa S Class power and precision with a state-of-the-art TrueTangential™ cutting head. It employs our most powerful servomotors yet and Summa's MicroSprocket™ drive to let you

Wahanahash      [2015-10-27 19:50:54 ]

Roland Hi-Fi JET Pro II FJ-540 54-inch Printer

Site wahanahash com Accept Paypal The Hi-Fi JET Pro II offers the best digital print quality in the industry. Thanks to variable droplet technology, 1440x1440 dpi resolution and precise media movement, this wide format inkjet printer is ideal for producing fine art reproductions

Wahanahash      [2015-10-27 19:47:15 ]

Graphtec CE5000-120

Site wahanahash com Accept Paypal The CE5000-120 (48") delivers a maximum cutting force of 450 grams and a maximum speed of 40 inches per second (45 degree angle.) and provides a 39-step range up to 450g cutting force. The built-in front control panel provides complete parameter

Wahanahash      [2015-10-27 19:41:20 ]

Mimaki JV5-160S Printer (63-inch)

Site wahanahash com Accept Paypal Mimaki has responded to the needs of power users and quick delivery, introducing the next generation of high speed-high quality wide format solvent inkjet printers. The JV5-160S are the next generation solvent inkjet printers equipped with newly

Wahanahash      [2015-10-27 19:40:14 ]

Roland GX-640 CAMM-1 Pro

Site wahanahash com Accept Paypal Power and Precision Equipped with the industry’s most powerful cutting motors , the GX-640 is ideal for long, uninterrupted production runs and years of reliable service for your business. In fact, GX-640 servo motors are the same motors that

Wahanahash      [2015-10-27 19:36:32 ]