SPECIFICATIONS Dimensions (L* W * H) 2250*2380*920mm Seating Capacity 7-8 adults Lounge Seat (s) 2 Water Capacity 1605 liters Filter Size 100sq ft. CONTRUCTION Spa Shell (USA) Lucite? Acrylic Color of Lucite Acrylic Shell Sterling silver Spa Cabinet Material PS Wood-Plastic Compo
SpaRelax Co.,Ltd [2015-11-05 15:25:59 ]
SPECIFICATIONS Dimensions (L* W * H) 2050*1750*800mm Seating Capacity 3 adults Lounge Seat (s) 1 Water Capacity 786 liters Filter Size 50sq ft. CONTRUCTION Spa Shell (USA) Lucite? Acrylic Color of Lucite Acrylic Shell Sterling silver Spa Cabinet Material PS Wood-Plastic Composite
SpaRelax Co.,Ltd [2015-11-05 15:25:35 ]
SPECIFICATIONS Dimensions (L* W * H) 2000*1200*840mm Seating Capacity 2adults Lounge Seat (s) 2 Water Capacity 605 liters Filter Size 50sq ft. CONTRUCTION Spa Shell (USA) Lucite? Acrylic Color of Lucite Acrylic Shell Sterling silver Spa Cabinet Material PS Wood-Plastic Composite
SpaRelax Co.,Ltd [2015-11-05 15:25:09 ]
SPECIFICATIONS Dimensions (L* W * H) 2250*1100*780mm Seating Capacity 2 adults Water Capacity 350 liters Filter Size 50sq ft. CONTRUCTION Spa Shell (USA) Lucite? Acrylic Color of Lucite Acrylic Shell Sterling silver Spa Cabinet Material PS Wood-Plastic Composite Panels Frame Pres
SpaRelax Co.,Ltd [2015-11-05 15:24:38 ]
Dimensions (L* W * H) 1800*1200*730mm Seating Capacity 1 adults Lounge Seat (s) 1 Water Capacity 350 liters Filter Size 50sq ft. CONTRUCTION Spa Shell (USA) Lucite? Acrylic Color of Lucite Acrylic Shell Sterling silver Spa Cabinet Material PS Wood-Plastic Composite Panels Cabinet
SpaRelax Co.,Ltd [2015-11-05 15:22:54 ]
Model BS3414-I BS3427-II Spreading Speed 30m/min 0-34m/min Diameter of spreading roller 245mm 345*2 Length of spreading roller 1400mm 2700mm Diameter of squeezing roller 180mm 240mm*2 Length of squeezing roller 1300mm 2700mm Power of the machine 4KW 5.5KW(adjustable speed motor)
临沂新天力机械有限公司 [2015-11-03 14:28:23 ]
Model TT-H 15C Wire diameter 0.6 -2.5mm Coil outside diamete 50 -200mm Max coil height 95mm Complete the internal diameter. 40mm (MIN) Spindle motor 750W alternating current motor , variable frequency drive Spreading motor stepping motor Power source AC220V; 50/60HZ Produc
Wisdom winding machine (shanghai) Co.,Ltd [2015-11-02 14:48:37 ]
Stanozolol (Winstrol) English Synonyms winstrol l;1,10a,12a-Trimethyl-1,2,3,3a,3b,4,5,5a,6,8,10,10a,10b,11,12,12a-hexadecahydrocyclopenta[5,6]naphtho[1,2-f]indazol-1-ol;1,2,3,3a,3b,4,5,5a,6,8,10,10a,10b,11,12,12a-hexadecahydro-1,10a,12a-trimethylc;17-Methyl-2'H-5alpha-androst-2-e
Zhuhai Shuangbojie Technology Co.,Ltd [2015-10-30 21:14:16 ]
Trenbolone Acetate English Synonyms 17-(acetyloxy)-(17-beta)-estra-11-trien-3-one;17-beta-acetoxy-delta-4,9,11-estratrien-3-one;17-beta-hydroxyestra-4,9,11-trien-3-oneacetate;9,11-trien-3-one,17-beta-hydroxy-estra-acetate;finaplix;ru1697;trienboloneacetate;revalor-h CAS NO. 10161
Zhuhai Shuangbojie Technology Co.,Ltd [2015-10-30 20:45:04 ]
Model W8 -KM512I-30PL-4H Printing Quality 360dpi Printing Speed Draft Mode 480X360dpi 2pass @ 120sqm/h Production Mode 480X540dpi 3pass @ 90sqm/h Quality Mode 480X720dpi 4pass @ 60sqm/h Model W8 -KM512I-30PL-8H Printing Quality 360dpi Printing Speed Draft Mode 480X360dpi 2pass @
WinJET [2015-10-30 16:07:40 ]
HYR830 adopts Impinj R2000 module, maximum power output is 31dbm. 4 RP TNC ports, with an 12dbi circular polarized antenna, reading distance can reach 24 meters. Reading speed is 400 tags/sec. Support LBT function. Support dense reader working mode(DRM) 8 LED lights, real-time di
联云星 [2015-10-30 15:49:46 ]
Stanozolol, Winstrol 99% Anabolic Stanozolol (CAS 10418-03-8) 99% Purity Stanozolol Coarse Winstrol Raw Powder Steroid Product Name Stanozolol Synonyms STANOZOL;STANOZOLOL;STANAZOL;winstrol l;1,10a,12a-Trimethyl-1,2,3,3a,3b,4,5,5a,6,8,10,10a,10b,11,12,12a-hexadecahydrocyclopenta[
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:52:00 ]
Trenbolone Acetate Anabolice Steroid Hormone Trenbolone Acetate with Safe Shipping Trenbolone Acetate 99% Min Finaplix Trenbolone Acetate Product Name Revalor-H Synonyms 17-(acetyloxy)-(17-beta)-estra-11-trien-3-one;17-beta-acetoxy-delta-4,9,11-estratrien-3-one;17-beta-hydroxyest
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:42:27 ]
Benzocaine Synonyms Aethoform;4-aminobenzoic acid ethyl ester;Labotest-bb ltbb000527;H-4-abz-oet;Ethyl 4-aminobenzoate;Ethyl p-aminobenzoate CAS 94-09-7 MF C9H11NO2 MW 165.19 EINECS 202-303-5 HS code 29224999.90 Product Categories Aromatic Esters;C8 to C9;Carbonyl Compounds;Ester
Zhuhai Shuangbojie Technology Co.,Ltd [2015-10-30 14:35:44 ]
Oxytocin, 2mg/vial CAS 50-56-6 synonyms oxytocin lyophilized; oxytocin acetate; H-Cys-Tyr-Ile-Gln-Asn-Cys-Pro-Leu-Gly-NH2 Disulfide bond; EINECS 200-048-4 MF C43H66N12O12S2 MW 1007.19 Grade Standard Medicine Grade Appearance White powder Oxytocin is a cyclic polypeptide with all
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:23:41 ]
Sermorelin, 2mg/vial Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-AR
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:23:18 ]
GHRP-6, 5mg/vial, 10mg/vial Product Name Growth hormone releasing peptide Synonyms sk&f110679;[D-TRP7, ALA8, D-PHE10]-ALPHA-MELANOCYTE STIMULATING HORMONE (6-11) AMIDE;[D-TRP7,ALA8,D-PHE10]-ALPHA-MELANOCYTE STIMULATING HORMONE FRAGMENT 6-11 AMIDE;(D-TRP7,ALA8,D-PHE10)-ALPHA-MSH (
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:22:04 ]
PT-141,Bremelanotide, 10mg/vial Molecular Formula C50H68N14O10 Molecular Weight 1025.16 CAS NO 189691-06-3 Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 1.Appearance White powder White powder 2 Solubility Soluble in water and 1% acetic acid Conforms 3 Specifical Optical Rotation
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:19:05 ]
The alternator has the following features 1. +- 1.0 % Voltage regulation (max.) in static conditions 2. IP 22 protection with insulation class H 3. Permissible overload of 10% for one hour in 12 hours of operation. The alternator/generators have been designed for use in a maximum
Jiangsu Farrand Alternator [2015-10-28 14:01:41 ]
Site wahanahash com Accept Paypal The VersaCAMM Series is highly versatile for an endless range of applications. With just one device, you can produce decals, labels, stickers, posters, POP, vehicle wraps, heat transfers for apparel decoration and other promotional items of any
Wahanahash [2015-10-27 19:58:01 ]
