Searching growth hormone , total 147 products,queries done in 0 ms
GHRP-2

This is Lily from Guangzhou HuAo Chemical Co Ltd. If the product is what you need, Please contact me. Quick Detail Product Name GHRP-2 Growth Hormone Releasing Peptide 2 GHRP Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular formula C45H55N9O6 Molar Mass 817.9 CAS number 1

广州市虎傲公司      [2015-11-10 14:26:38 ]

Tesamorelin, 2mg/vial

Tesamorelin, 2mg/vial Sequence C6H9O-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 CAS # 218949-48-5 Molecular Formula C211H366N72O67S1 Molecular

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:26:12 ]

HGH 176-191, 2mg/vial

HGH 176-191, 2mg/vial Molucular Formula C78H123N23O23S2 Molecular weight 1815.08 Peptide purity > 98.0% Appearance White powder Related substance Total Impurities(%) ≤ 2.0% Acetate content ≤ 15.0% Bacterial Endotoxins ≤5 IU/mg Chain Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-G

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:25:06 ]

Sermorelin, 2mg/vial

Sermorelin, 2mg/vial Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-AR

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:23:18 ]

Hexarelin, 2mg/vial

Hexarelin, 2mg/vial Product Name Hexarelin Synonyms HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE RELEASING HEXAPEPTIDE;Examorelin;Hexareline;L-Histidyl-2-methyl-D-tryptophyl-L-alanyl-L-tryptophyl-D-phenylalanyl-L-lysinamide;M W. 8

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:22:53 ]

Ipamorelin, 2mg/vial

Ipamorelin, 2mg/vial CAS No. 170851-70-4 Other Names Ipamorelin MF C38H49N9O5 Place of Origin Zhejiang China (Mainland) Type Pharmaceutical Intermediates Purity 99% Molecular Weight 711.86 Purpose Build tight lean muscle, reduce body fat and decrease water retention with Ipamorel

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:22:29 ]

GHRP-6, 5mg/vial, 10mg/vial

GHRP-6, 5mg/vial, 10mg/vial Product Name Growth hormone releasing peptide Synonyms sk&f110679;[D-TRP7, ALA8, D-PHE10]-ALPHA-MELANOCYTE STIMULATING HORMONE (6-11) AMIDE;[D-TRP7,ALA8,D-PHE10]-ALPHA-MELANOCYTE STIMULATING HORMONE FRAGMENT 6-11 AMIDE;(D-TRP7,ALA8,D-PHE10)-ALPHA-MSH (

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:22:04 ]

GHRP-2, 5mg/vial, 10mg/vial

GHRP-2, 5mg/vial, 10mg/vial Product Name Pralmorelin Synonyms PRALMORELIN;D-ALA-D-NAL(2)-ALA-TRP-D-PHE-LYS-NH2 ACETATE SALT;D-ALA-BETA-(2-NAPHTHYL)-D-ALA-TRP-D-PHE-LYS AMIDE;D-ALA-D-2-NAL-ALA-TRP-D-PHE-LYS-NH2;(DES-ALA3,D-ALA1,D-2-NAL2)-GHRP-6;(DES-ALA3)-GHRP-2;(DES-ALA3)-GROWTH

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:21:08 ]

CJC-1295 DAC, 2mg/vial

CJC-1295 DAC, 2mg/vial Cas No. 863288-34-0 CJC 1295 DAC, a long acting GHRH polypeptide, causes the anterior pituitary’s somatotropes to release growth hormone. DAC conjugated CJC 1295, makes this GHRH have a half life of more than a week (approx. 8 days). GHRH is released in p

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:17:21 ]

Sermorelin(2mg/vial,10vials/kit) Hexarelin High Quality HGH Suppiler

About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply RHGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1, Blue top, Red top,

Hongkong Green Sci Biotech CO. Ltd      [2015-09-28 15:27:37 ]

Igtropin Authentic HGH 100%Original Factory Price

About Us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,

Hongkong Green Sci Biotech CO. Ltd      [2015-09-28 15:25:57 ]

HGH Kigtropin Riptropin Jintropin 99% High Purity HGH

Introduction Kigtropin HGH is a Human Growth Hormone (hGH) Somatropin produced with recombinant DNA technology identical to the body naturally produced HGH. Following are the reported benefits of use of Kigtropin HGH · Losing Cellulite and Wrinkles · Gaining muscle / losing fat

Hongkong Green Sci Biotech CO. Ltd      [2015-09-28 15:19:27 ]

PEG-MGF(2mg/vial.10vials/kit) High Quality HGH

About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,

Hongkong Green Sci Biotech CO. Ltd      [2015-09-28 15:14:55 ]

Hygetropin 200iu Jintropin Kigtropin Taitropin 100%Original Factory Price

About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,

Hongkong Green Sci Biotech CO. Ltd      [2015-09-28 15:09:09 ]

Jintropin 100iu HGH Gensci 100% Original HGH Wholesale Price With Top Quality

About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,

Hongkong Green Sci Biotech CO. Ltd      [2015-09-28 15:06:07 ]

Diamond Top Green / Blue / Red Top High Purity HGH Factory Price

About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,

Hongkong Green Sci Biotech CO. Ltd      [2015-09-28 15:03:41 ]

Taitropin 100iu 100%Original HGH Factory Price

About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,

Hongkong Green Sci Biotech CO. Ltd      [2015-09-28 15:01:36 ]

Wholesale Price Buy Kigtropin 100iu High Purity HGH Top Quality

About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,

Hongkong Green Sci Biotech CO. Ltd      [2015-09-28 14:58:10 ]

Gensci Jintropin 100iu 100%Original HGH Factory Price

About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,

Hongkong Green Sci Biotech CO. Ltd      [2015-09-28 14:55:40 ]

Insulin Peptide Hormone Increase Muscle HGH 100%Original

About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,

Hongkong Green Sci Biotech CO. Ltd      [2015-09-28 14:50:09 ]