This is Lily from Guangzhou HuAo Chemical Co Ltd. If the product is what you need, Please contact me. Quick Detail Product Name GHRP-2 Growth Hormone Releasing Peptide 2 GHRP Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular formula C45H55N9O6 Molar Mass 817.9 CAS number 1
广州市虎傲公司 [2015-11-10 14:26:38 ]
Tesamorelin, 2mg/vial Sequence C6H9O-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 CAS # 218949-48-5 Molecular Formula C211H366N72O67S1 Molecular
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:26:12 ]
HGH 176-191, 2mg/vial Molucular Formula C78H123N23O23S2 Molecular weight 1815.08 Peptide purity > 98.0% Appearance White powder Related substance Total Impurities(%) ≤ 2.0% Acetate content ≤ 15.0% Bacterial Endotoxins ≤5 IU/mg Chain Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-G
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:25:06 ]
Sermorelin, 2mg/vial Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-AR
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:23:18 ]
Hexarelin, 2mg/vial Product Name Hexarelin Synonyms HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE RELEASING HEXAPEPTIDE;Examorelin;Hexareline;L-Histidyl-2-methyl-D-tryptophyl-L-alanyl-L-tryptophyl-D-phenylalanyl-L-lysinamide;M W. 8
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:22:53 ]
Ipamorelin, 2mg/vial CAS No. 170851-70-4 Other Names Ipamorelin MF C38H49N9O5 Place of Origin Zhejiang China (Mainland) Type Pharmaceutical Intermediates Purity 99% Molecular Weight 711.86 Purpose Build tight lean muscle, reduce body fat and decrease water retention with Ipamorel
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:22:29 ]
GHRP-6, 5mg/vial, 10mg/vial Product Name Growth hormone releasing peptide Synonyms sk&f110679;[D-TRP7, ALA8, D-PHE10]-ALPHA-MELANOCYTE STIMULATING HORMONE (6-11) AMIDE;[D-TRP7,ALA8,D-PHE10]-ALPHA-MELANOCYTE STIMULATING HORMONE FRAGMENT 6-11 AMIDE;(D-TRP7,ALA8,D-PHE10)-ALPHA-MSH (
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:22:04 ]
GHRP-2, 5mg/vial, 10mg/vial Product Name Pralmorelin Synonyms PRALMORELIN;D-ALA-D-NAL(2)-ALA-TRP-D-PHE-LYS-NH2 ACETATE SALT;D-ALA-BETA-(2-NAPHTHYL)-D-ALA-TRP-D-PHE-LYS AMIDE;D-ALA-D-2-NAL-ALA-TRP-D-PHE-LYS-NH2;(DES-ALA3,D-ALA1,D-2-NAL2)-GHRP-6;(DES-ALA3)-GHRP-2;(DES-ALA3)-GROWTH
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:21:08 ]
CJC-1295 DAC, 2mg/vial Cas No. 863288-34-0 CJC 1295 DAC, a long acting GHRH polypeptide, causes the anterior pituitary’s somatotropes to release growth hormone. DAC conjugated CJC 1295, makes this GHRH have a half life of more than a week (approx. 8 days). GHRH is released in p
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:17:21 ]
About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply RHGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1, Blue top, Red top,
Hongkong Green Sci Biotech CO. Ltd [2015-09-28 15:27:37 ]
About Us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,
Hongkong Green Sci Biotech CO. Ltd [2015-09-28 15:25:57 ]
Introduction Kigtropin HGH is a Human Growth Hormone (hGH) Somatropin produced with recombinant DNA technology identical to the body naturally produced HGH. Following are the reported benefits of use of Kigtropin HGH · Losing Cellulite and Wrinkles · Gaining muscle / losing fat
Hongkong Green Sci Biotech CO. Ltd [2015-09-28 15:19:27 ]
About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,
Hongkong Green Sci Biotech CO. Ltd [2015-09-28 15:14:55 ]
About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,
Hongkong Green Sci Biotech CO. Ltd [2015-09-28 15:09:09 ]
About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,
Hongkong Green Sci Biotech CO. Ltd [2015-09-28 15:06:07 ]
About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,
Hongkong Green Sci Biotech CO. Ltd [2015-09-28 15:03:41 ]
About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,
Hongkong Green Sci Biotech CO. Ltd [2015-09-28 15:01:36 ]
About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,
Hongkong Green Sci Biotech CO. Ltd [2015-09-28 14:58:10 ]
About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,
Hongkong Green Sci Biotech CO. Ltd [2015-09-28 14:55:40 ]
About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,
Hongkong Green Sci Biotech CO. Ltd [2015-09-28 14:50:09 ]
