CAS NO 159752-10-0 Molecular Formula C27H36N4O5S CH4O3S Molecular weight 624.776 Appearance Powder Detail MK-677 also known as Ibutamoren, MK-0677, L-163,191 is a non-peptidic, potent, long-acting, orally-active, and selective agonist of the ghrelin receptor and a growth hormone
Wuhan Fantaike pharmaceutical Technology Co., Ltd. [2017-09-13 15:25:26 ]
Product Name MK-677 CAS NO 159752-10-0 Molecular Formula C27H36N4O5S CH4O3S Molecular weight 624.776 Appearance Powder Detail MK-677 also known as Ibutamoren, MK-0677, L-163,191 is a non-peptidic, potent, long-acting, orally-active, and selective agonist of the ghrelin receptor a
Wuhan Fantaike pharmaceutical Technology Co., Ltd. [2017-08-29 10:10:33 ]
Quick DetailS Kigtropin Assay 97% Model 10iu/vial Package 10vial/kit Apperance White Lyophilized powder. Manufacturer Hezhong Usage For anti-aging, general health & healing, fat mobilization, a dose of 2-3 IU\'s per day will be sufficient for the majority. A dose of 1.5 to 2.0
Wuhan Jin Shengyu biological technology co., LTD [2017-07-21 21:00:50 ]
(20iu/kit, 40iu/kit, 45iu/kit, 60iu/kit, 100iu/kit,160iu/kit) EP/USP standard Direct Factory Price No-worry service ( Guaranteed delivery to you door ) Original Ansomone HGH is one of the most recommended HGH supplements in body-building, anti-aging community etc for more than 20
Anhui Anke Biotechnology (Group) Co., Ltd [2017-04-06 15:18:34 ]
BCAA Powder CAS 69430-36-0 Category Food Additives cas no. 69430-36-0 type nutrition enhancers Product Description 1.The essential branched chain amino acids (BCAA\'s) include leucine, isoleucine, and valine are of special importance for athletes because they are metabolized in t
Guangdong Huao Biochemical Co.ltd [2017-02-21 15:03:47 ]
HGH 176-191 H 176-191 2mg/vial 1.product descroption The H Fragment is a modified form of amino acids 176-191 at the C-terminal region of the human growth hormone (HGH). Studies have shown that it works by mimicking the way natural HGH regulates fat metabolism but without the adv
YuanCheng SaiChuang Technology Co. LTD, [2017-01-19 08:57:41 ]
CJC-1295 without DAC Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Cas No. 863288-34-0 Molecular Formula C165H271N47O46 Molecular Weight 3649.30 Purity (HPLC) 98.0% Single
YuanCheng SaiChuang Technology Co. LTD, [2017-01-19 08:45:10 ]
Product Name CJC-1295 Acetate Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Cas No. 863288-34-0 Molecular Formula C165H271N47O46 Molecular Weight 3649.30 Purity (HPLC) 98.
YuanCheng SaiChuang Technology Co. LTD, [2017-01-19 08:43:34 ]
(20iu/kit, 40iu/kit, 45iu/kit, 60iu/kit, 100iu/kit,160iu/kit) EP/USP standard Direct Factory Price No-worry service ( Guaranteed delivery to you door ) Original Ansomone HGH is one of the most recommended HGH supplements in body-building, anti-aging community etc for more than 20
Anhui Anke Biotechnology (Group) Co., Ltd [2016-12-20 09:47:07 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Growth Hormone peptide fragment 176-191, also known as HGH Frag 176-191, is a modified form of amino acids 176-191 of the GH polypeptide. Investigators at Monash University discovered that t
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:02:01 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-G
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:58:01 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Hexarelin Synonyms HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE RELEASING HEXAPEPTIDE;Examorelin;Hexareline;L-Histidyl-2-methyl
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:55:45 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com GHRP-6 (Growth hormone releasing peptide) Alias GROWTH HORMONE RELEASING PEPTIDE-6; [HIS1, LYS6]-GHRP; HIS-D-TRP-ALA-TRP-D-PHE-LYS-NH2; H-HIS-D-TRP-ALA-TRP-D-PHE-LYS-NH2 CAS 87616-84-0 Purit
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:37:48 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Quick Detail Product Name GHRP-2 Growth Hormone Releasing Peptide 2 GHRP Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular formula C45H55N9O6 Molar Mass 817.9 CAS number 158861-67-7 P
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:36:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com CJC-1295 Alias CJC-1295 Acetate; CJC1295(Without DAC); Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys (Mal
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:28:33 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com CJC-1295 DAC (Drug Affinity Complex) Alias CJC1295(GHRH/DAC) Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Ly
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:27:44 ]
Packaging & Delivery Packaging Details in 190kg drums Delivery Detail Fish oil is available for shipment Specifications Fish oil produced from Fresh Pangasius ( Tra/ Basa) by products, with a day . Low AV value ( Below 3 guarantee) Product description + Acid value ≤ 2 mg KOH /
Wudi Deda Agriculture Co., Ltd. [2016-11-28 15:31:24 ]
Product name Riptropin 10iu Package 100iu/10vails/1 kit Riptropin is recombinant human growth hormone somatropin for injection Recommended Dosage the average daily dosage is prescribed between 0.005mg and 0.006mg per kilo of body weight. Storage Keep at 2-8C. The product can st
Health222chem3 INC [2016-10-20 23:43:19 ]
Product name Kigtropin 10iu Package 100iu/10vails/1 kit Kigtropin is a recombinant human growth hormone. Kigtropin is produced by recombinant DNA technology in E coli secretion expression system. Somatropin has the same amino acid sequence with 191 residues as the native human gr
Health222chem3 INC [2016-10-20 23:42:22 ]
Product name Jintropin 10iu Package 100iu/10vails/1 kit Pediatric growth retardation due to inadequate secretion of endogenous growth hormone. Hgh injections for Severe burns. Growth hormone deficiency (GHD) due to diseases of hypothalamus-pituitary gland. Or as diagnosed by 2 in
Health222chem3 INC [2016-10-20 23:41:26 ]
