Searching growth hormone , total 147 products,queries done in 0 ms
Ibutamoren

CAS NO 159752-10-0 Molecular Formula C27H36N4O5S CH4O3S Molecular weight 624.776 Appearance Powder Detail MK-677 also known as Ibutamoren, MK-0677, L-163,191 is a non-peptidic, potent, long-acting, orally-active, and selective agonist of the ghrelin receptor and a growth hormone

Wuhan Fantaike pharmaceutical Technology Co., Ltd.      [2017-09-13 15:25:26 ]

New Product MK-677

Product Name MK-677 CAS NO 159752-10-0 Molecular Formula C27H36N4O5S CH4O3S Molecular weight 624.776 Appearance Powder Detail MK-677 also known as Ibutamoren, MK-0677, L-163,191 is a non-peptidic, potent, long-acting, orally-active, and selective agonist of the ghrelin receptor a

Wuhan Fantaike pharmaceutical Technology Co., Ltd.      [2017-08-29 10:10:33 ]

Healthy Legit Kigtropin HGH Human Growth Hormone For Losing Cellulite And Wrinkles

Quick DetailS Kigtropin Assay 97% Model 10iu/vial Package 10vial/kit Apperance White Lyophilized powder. Manufacturer Hezhong Usage For anti-aging, general health & healing, fat mobilization, a dose of 2-3 IU\'s per day will be sufficient for the majority. A dose of 1.5 to 2.0

Wuhan Jin Shengyu biological technology co., LTD      [2017-07-21 21:00:50 ]

China original HGH-ANSOMONE by ANKEBIO

(20iu/kit, 40iu/kit, 45iu/kit, 60iu/kit, 100iu/kit,160iu/kit) EP/USP standard Direct Factory Price No-worry service ( Guaranteed delivery to you door ) Original Ansomone HGH is one of the most recommended HGH supplements in body-building, anti-aging community etc for more than 20

Anhui Anke Biotechnology (Group) Co., Ltd      [2017-04-06 15:18:34 ]

BCAA Powder

BCAA Powder CAS 69430-36-0 Category Food Additives cas no. 69430-36-0 type nutrition enhancers Product Description 1.The essential branched chain amino acids (BCAA\'s) include leucine, isoleucine, and valine are of special importance for athletes because they are metabolized in t

Guangdong Huao Biochemical Co.ltd      [2017-02-21 15:03:47 ]

HGH 176-191

HGH 176-191 H 176-191 2mg/vial 1.product descroption The H Fragment is a modified form of amino acids 176-191 at the C-terminal region of the human growth hormone (HGH). Studies have shown that it works by mimicking the way natural HGH regulates fat metabolism but without the adv

YuanCheng SaiChuang Technology Co. LTD,      [2017-01-19 08:57:41 ]

CJC-1295 without DAC

CJC-1295 without DAC Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Cas No. 863288-34-0 Molecular Formula C165H271N47O46 Molecular Weight 3649.30 Purity (HPLC) 98.0% Single

YuanCheng SaiChuang Technology Co. LTD,      [2017-01-19 08:45:10 ]

CJC-1295 Acetate

Product Name CJC-1295 Acetate Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Cas No. 863288-34-0 Molecular Formula C165H271N47O46 Molecular Weight 3649.30 Purity (HPLC) 98.

YuanCheng SaiChuang Technology Co. LTD,      [2017-01-19 08:43:34 ]

original ANSOMONE HGH with Unique anti-counterfeiting code

(20iu/kit, 40iu/kit, 45iu/kit, 60iu/kit, 100iu/kit,160iu/kit) EP/USP standard Direct Factory Price No-worry service ( Guaranteed delivery to you door ) Original Ansomone HGH is one of the most recommended HGH supplements in body-building, anti-aging community etc for more than 20

Anhui Anke Biotechnology (Group) Co., Ltd      [2016-12-20 09:47:07 ]

HGH Fragment (176-191)

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Growth Hormone peptide fragment 176-191, also known as HGH Frag 176-191, is a modified form of amino acids 176-191 of the GH polypeptide. Investigators at Monash University discovered that t

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:02:01 ]

Sermorelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-G

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:58:01 ]

Hexarelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Hexarelin Synonyms HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE RELEASING HEXAPEPTIDE;Examorelin;Hexareline;L-Histidyl-2-methyl

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:55:45 ]

GHRP-6

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com GHRP-6 (Growth hormone releasing peptide) Alias GROWTH HORMONE RELEASING PEPTIDE-6; [HIS1, LYS6]-GHRP; HIS-D-TRP-ALA-TRP-D-PHE-LYS-NH2; H-HIS-D-TRP-ALA-TRP-D-PHE-LYS-NH2 CAS 87616-84-0 Purit

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:37:48 ]

GHRP-2

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Quick Detail Product Name GHRP-2 Growth Hormone Releasing Peptide 2 GHRP Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular formula C45H55N9O6 Molar Mass 817.9 CAS number 158861-67-7 P

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:36:57 ]

CJC-1295

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com CJC-1295 Alias CJC-1295 Acetate; CJC1295(Without DAC); Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys (Mal

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:28:33 ]

CJC-1295 DAC

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com CJC-1295 DAC (Drug Affinity Complex) Alias CJC1295(GHRH/DAC) Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Ly

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:27:44 ]

fish oil

Packaging & Delivery Packaging Details in 190kg drums Delivery Detail Fish oil is available for shipment Specifications Fish oil produced from Fresh Pangasius ( Tra/ Basa) by products, with a day . Low AV value ( Below 3 guarantee) Product description + Acid value ≤ 2 mg KOH /

Wudi Deda Agriculture Co., Ltd.      [2016-11-28 15:31:24 ]

Riptropin 10iu /skype:mike_health205

Product name Riptropin 10iu Package 100iu/10vails/1 kit Riptropin is recombinant human growth hormone somatropin for injection Recommended Dosage the average daily dosage is prescribed between 0.005mg and 0.006mg per kilo of body weight. Storage Keep at 2-8C. The product can st

Health222chem3 INC      [2016-10-20 23:43:19 ]

Kigtropin 10iu /skype:mike_health205

Product name Kigtropin 10iu Package 100iu/10vails/1 kit Kigtropin is a recombinant human growth hormone. Kigtropin is produced by recombinant DNA technology in E coli secretion expression system. Somatropin has the same amino acid sequence with 191 residues as the native human gr

Health222chem3 INC      [2016-10-20 23:42:22 ]

Jintropin 10iu /skype:mike_health205

Product name Jintropin 10iu Package 100iu/10vails/1 kit Pediatric growth retardation due to inadequate secretion of endogenous growth hormone. Hgh injections for Severe burns. Growth hormone deficiency (GHD) due to diseases of hypothalamus-pituitary gland. Or as diagnosed by 2 in

Health222chem3 INC      [2016-10-20 23:41:26 ]