growth hormone - Manufacturers, Suppliers & Exporters
Quick DetailS Kigtropin Assay 97% Model 10iu/vial Package 10vial/kit Apperance White Lyophilized powder. Manufacturer Hezhong Usage For anti-aging, general health & healing, fat mobilization, a dose of 2-3 IU\'s per day will be sufficient for the majority. A dose of 1.5 to 2.0
Wuhan Jin Shengyu biological technology co., LTD [2017-07-21 21:00:50 ]
BCAA Powder CAS 69430-36-0 Category Food Additives cas no. 69430-36-0 type nutrition enhancers Product Description 1.The essential branched chain amino acids (BCAA\'s) include leucine, isoleucine, and valine are of special importance for athletes because they are metabolized in t
Guangdong Huao Biochemical Co.ltd [2017-02-21 15:03:47 ]
(20iu/kit, 40iu/kit, 45iu/kit, 60iu/kit, 100iu/kit,160iu/kit) EP/USP standard Direct Factory Price No-worry service ( Guaranteed delivery to you door ) Original Ansomone HGH is one of the most recommended HGH supplements in body-building, anti-aging community etc for more than 20
Anhui Anke Biotechnology (Group) Co., Ltd [2016-12-20 09:47:07 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Growth Hormone peptide fragment 176-191, also known as HGH Frag 176-191, is a modified form of amino acids 176-191 of the GH polypeptide. Investigators at Monash University discovered that t
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:02:01 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-G
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:58:01 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Hexarelin Synonyms HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE RELEASING HEXAPEPTIDE;Examorelin;Hexareline;L-Histidyl-2-methyl
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:55:45 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com GHRP-6 (Growth hormone releasing peptide) Alias GROWTH HORMONE RELEASING PEPTIDE-6; [HIS1, LYS6]-GHRP; HIS-D-TRP-ALA-TRP-D-PHE-LYS-NH2; H-HIS-D-TRP-ALA-TRP-D-PHE-LYS-NH2 CAS 87616-84-0 Purit
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:37:48 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Quick Detail Product Name GHRP-2 Growth Hormone Releasing Peptide 2 GHRP Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular formula C45H55N9O6 Molar Mass 817.9 CAS number 158861-67-7 P
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:36:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com CJC-1295 Alias CJC-1295 Acetate; CJC1295(Without DAC); Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys (Mal
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:28:33 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com CJC-1295 DAC (Drug Affinity Complex) Alias CJC1295(GHRH/DAC) Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Ly
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:27:44 ]
Packaging & Delivery Packaging Details in 190kg drums Delivery Detail Fish oil is available for shipment Specifications Fish oil produced from Fresh Pangasius ( Tra/ Basa) by products, with a day . Low AV value ( Below 3 guarantee) Product description + Acid value ≤ 2 mg KOH /
Wudi Deda Agriculture Co., Ltd. [2016-11-28 15:31:24 ]
CJC-1295 DAC Increase GH Production Intramuscular Injection CJC-1295 For more details Plz contact lmy@ycphar com Skype miss littlemegan Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-LysLys(Maleimidop
Tai'an City Jia biotechnology industry Co.Ltd [2016-10-17 15:23:54 ]
CAS NO. 66004-57-7 Molecular Formula C78H125N23O23S2 Molecular weight 1817.12 Peptide purity > 98.0% Appearance White lyophilized powder Related substance Total Impurities (%) Acetate content Bacterial Endotoxins Form & Formulations Sterile Filtered white lyophilized (freeze-drie
Tai'an City Jia biotechnology industry Co.Ltd [2016-10-17 15:08:27 ]
Hgh Fragment 176-191 Human Growth Hormone Keep Young Anti-age HGH Frag 176-191 Sequence For more details Plz contact lmy@ycphar com HGH fragments refer to modified forms of amino acids, in this case amino acid 176-191. Studies indicate that this chemical has potential use in impr
Tai'an City Jia biotechnology industry Co.Ltd [2016-10-11 17:52:42 ]
Product Name CJC-1295 Acetate Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Cas No. 863288-34-0 Molecular Formula C165H271N47O46 Molecular Weight 3649.30 Purity (HPLC) 98.
Wuhan Yuancheng Phamacy Co., Ltd [2016-09-24 10:21:53 ]
CJC-1295 without DAC Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Cas No. 863288-34-0 Molecular Formula C165H271N47O46 Molecular Weight 3649.30 Purity (HPLC) 98.0% Single
Wuhan Yuancheng Phamacy Co., Ltd [2016-09-07 16:27:33 ]
HGH 176-191 H 176-191 1.product descroption The H Fragment is a modified form of amino acids 176-191 at the C-terminal region of the human growth hormone (HGH). Studies have shown that it works by mimicking the way natural HGH regulates fat metabolism but without the adverse effe
Wuhan Yuancheng Phamacy Co., Ltd [2016-09-07 16:12:09 ]
Product Name CJC-1295 Acetate Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Cas No. 863288-34-0 Molecular Formula C165H271N47O46 Molecular Weight 3649.30 Purity (HPLC) 98.
HB YUANCHENG SAICHUANG TECHNOLOGY CO., LTD [2016-08-31 11:20:17 ]
HGH 176-191 H 176-191 2mg/vial 1.product descroption The H Fragment is a modified form of amino acids 176-191 at the C-terminal region of the human growth hormone (HGH). Studies have shown that it works by mimicking the way natural HGH regulates fat metabolism but without the adv
HB YUANCHENG SAICHUANG TECHNOLOGY CO., LTD [2016-08-31 10:54:40 ]
HGH 176-191 H 176-191 2mg/vial 1.product descroption The H Fragment is a modified form of amino acids 176-191 at the C-terminal region of the human growth hormone (HGH). Studies have shown that it works by mimicking the way natural HGH regulates fat metabolism but without the adv
HB YUANCHENG SAICHUANG TECHNOLOGY CO., LTD [2016-08-31 09:33:11 ]
