growth hormone - Manufacturers, Suppliers & Exporters

Total 132 products found
CJC-1295 without DAC

CJC-1295 without DAC Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Cas No. 863288-34-0 Molecular Formula C165H271N47O46 Molecular Weight 3649.30 Purity (HPLC) 98.0% Single

HB YUANCHENG SAICHUANG TECHNOLOGY CO., LTD      [2016-08-31 09:22:18 ]

CJC-1295 Acetate

Product Name CJC-1295 Acetate Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Cas No. 863288-34-0 Molecular Formula C165H271N47O46 Molecular Weight 3649.30 Purity (HPLC) 98.

HB YUANCHENG SAICHUANG TECHNOLOGY CO., LTD      [2016-08-31 09:21:17 ]

L-Glutamine

L-Glutamine CAS 56-85-9 Molecular Formula C5H10N2O3 Molecular Weight 146.15 Molecular Structure Characteristics White crystalline powder with barely perceptile out and acid taste. Solubility soluble in hot water, slightly soluble in water, practically insoluble in ethanol、aceto

Guangzhou Huao Chemical CO.,Ltd      [2016-08-15 08:58:55 ]

L-Arginine

Legal number (CAS RN) 74-79-3 Molecular formula C6H14N4O2 Molecular weight 174.2 Physical and chemical properties hydrochloride is white or almost white crystalline powder hydrochloride, odourless, an indication. 218 ℃ when roasting knot, 225 ℃ and then into a solid. Melting

Hebei Dasho Biotechnology Co., Ltd      [2016-05-09 18:21:25 ]

Alpha GPC/28319-77-9/99%,50% powder

Alpha-glycerophosphocholine(Alpha-GPC) Product Name:Alpha-GPC Introduction Alpha-glycerophosphocholine (Alpha-GPC or α-GPC) is a cholinergic compound that is used for its cognitive-promoting properties, and to enhance power output in athletes. It appears to also support ce

Wuxi Cima Science      [2016-04-28 13:05:15 ]

Alpha-GPC 50% powder /28319-77-9

Alpha-glycerophosphocholine ( Alpha-GPC ) Product Name : Alpha-GPC Introduction Alpha-glycerophosphocholine (Alpha-GPC or α-GPC) is a cholinergic compound that is used for its cognitive-promoting properties, and to enhance power output in athletes. It appears to also suppo

Wuxi Cima Science      [2016-04-25 15:01:12 ]

Alpha-glycerophosphocholine(Alpha-GPC)/28319-77-9

roduct Name : Alpha-GPC Introduction Alpha-glycerophosphocholine is a cholinergic compound that is used for its cognitive-promoting properties, and to enhance power output in athletes. It appears to also support cellular membranes, and may aid in preventing cognitive decline. C

Wuxi Cima Science      [2016-04-25 14:57:24 ]

Hexarelin service01@chembj.com

Quick detail; Sequence His-D-2-methyl-Trp-Ala-Trp-D-Phe-Lys-NH2 Molecular formula C47H58N12O6 Molar Mass 887.04022 CAS number 140703-51-1 PubChem CID 5464109 Synonyms Hexarelin Acetate, HEX, Examorelin Hexarelin is becoming a popular choice as a performance enhancement drug. Desc

Zhuhai Shuangbojie Pharmaceutical Technology Co.,Ltd      [2016-03-24 17:42:37 ]

HGH(human growth hormone)

HGH(human growth hormone) 100iu Ordinary HGH 80iu Glotropin 100iu Hygetropin 100iu Jintropin 100iu Kigtropin

KangRui BIO-TECH Co.,Ltd.(H.K.)      [2016-03-15 09:17:51 ]

Hgh Fragment 176-191

Hgh Fragment 176-191 Human Growth Hormone Keep Yonug Anti-age HGH Frag 176-191 Sequence H-Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe-OH One Letter Sequence YLRIVQCRSVEGSCGF Physical Apperance White Powder Form & Formulations Sterile Filtered white lyophilized

Hubei Yuancheng Saichuang *Technology Co., Ltd.      [2015-12-03 09:35:02 ]

GHRP-2

This is Lily from Guangzhou HuAo Chemical Co Ltd. If the product is what you need, Please contact me. Quick Detail Product Name GHRP-2 Growth Hormone Releasing Peptide 2 GHRP Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular formula C45H55N9O6 Molar Mass 817.9 CAS number 1

广州市虎傲公司      [2015-11-10 14:26:38 ]

Tesamorelin, 2mg/vial

Tesamorelin, 2mg/vial Sequence C6H9O-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2 CAS # 218949-48-5 Molecular Formula C211H366N72O67S1 Molecular

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:26:12 ]

HGH 176-191, 2mg/vial

HGH 176-191, 2mg/vial Molucular Formula C78H123N23O23S2 Molecular weight 1815.08 Peptide purity > 98.0% Appearance White powder Related substance Total Impurities(%) ≤ 2.0% Acetate content ≤ 15.0% Bacterial Endotoxins ≤5 IU/mg Chain Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-G

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:25:06 ]

Sermorelin, 2mg/vial

Sermorelin, 2mg/vial Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-AR

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:23:18 ]

Hexarelin, 2mg/vial

Hexarelin, 2mg/vial Product Name Hexarelin Synonyms HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE RELEASING HEXAPEPTIDE;Examorelin;Hexareline;L-Histidyl-2-methyl-D-tryptophyl-L-alanyl-L-tryptophyl-D-phenylalanyl-L-lysinamide;M W. 8

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:22:53 ]

Ipamorelin, 2mg/vial

Ipamorelin, 2mg/vial CAS No. 170851-70-4 Other Names Ipamorelin MF C38H49N9O5 Place of Origin Zhejiang China (Mainland) Type Pharmaceutical Intermediates Purity 99% Molecular Weight 711.86 Purpose Build tight lean muscle, reduce body fat and decrease water retention with Ipamorel

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:22:29 ]

GHRP-6, 5mg/vial, 10mg/vial

GHRP-6, 5mg/vial, 10mg/vial Product Name Growth hormone releasing peptide Synonyms sk&f110679;[D-TRP7, ALA8, D-PHE10]-ALPHA-MELANOCYTE STIMULATING HORMONE (6-11) AMIDE;[D-TRP7,ALA8,D-PHE10]-ALPHA-MELANOCYTE STIMULATING HORMONE FRAGMENT 6-11 AMIDE;(D-TRP7,ALA8,D-PHE10)-ALPHA-MSH (

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:22:04 ]

GHRP-2, 5mg/vial, 10mg/vial

GHRP-2, 5mg/vial, 10mg/vial Product Name Pralmorelin Synonyms PRALMORELIN;D-ALA-D-NAL(2)-ALA-TRP-D-PHE-LYS-NH2 ACETATE SALT;D-ALA-BETA-(2-NAPHTHYL)-D-ALA-TRP-D-PHE-LYS AMIDE;D-ALA-D-2-NAL-ALA-TRP-D-PHE-LYS-NH2;(DES-ALA3,D-ALA1,D-2-NAL2)-GHRP-6;(DES-ALA3)-GHRP-2;(DES-ALA3)-GROWTH

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:21:08 ]

CJC-1295 DAC, 2mg/vial

CJC-1295 DAC, 2mg/vial Cas No. 863288-34-0 CJC 1295 DAC, a long acting GHRH polypeptide, causes the anterior pituitary’s somatotropes to release growth hormone. DAC conjugated CJC 1295, makes this GHRH have a half life of more than a week (approx. 8 days). GHRH is released in p

Zhuhaishi Shuangbojie Technology Co., Ltd      [2015-10-30 14:17:21 ]

Sermorelin(2mg/vial,10vials/kit) Hexarelin High Quality HGH Suppiler

About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply RHGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1, Blue top, Red top,

Hongkong Green Sci Biotech CO. Ltd      [2015-09-28 15:27:37 ]