Molecular Formula C10H14BrNO2 IUPAC Molar mass 260.13 g/mol 2C-B is a psychedelic drug. It was first synthesized by Alexander Shulgin in 1974. In Shulgin\'s book PiHKAL, the dosage range is listed as 12–24 mg. 2C-B is sold as a white powder sometimes pressed in tablets or gel
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:46:51 ]
A-PVP Synonyms A-pvp 2-(1-pyrrolidinyl)-Valerophenone O-2387 Formal Name 1-phenyl-2-(1-pyrrolidinyl)-1-pentanone, monohydrochloride CAS Number 5485-65-4 Molecular Formula C15H21NO • HCl Formula Weight 267.8 Formulation A crystalline solid We are a pro
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:45:57 ]
clonazolam Clonazolam (also known as clonitrazolam) is a benzodiazepine that has been sold online as a designer drug. Systematic (IUPAC) name 6-(2-chlorophenyl)-1-methyl-8-nitro-4H-[1,2,4]triazolo[4,3-a][1,4]benzodiazepine CAS Number 33887-02-4 Chemical data Formula C17H12ClN5
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:45:04 ]
hydrocarbon e Hydrocodone is a semi-synthetic opioid derived from codeine. Hydrocodone is used orally as a narcotic analgesic and antitussive, often in combination with paracetamol or ibuprofen. We are a professional supplier of alprazolam, etizolam, diclazepam, hydrocodone, clon
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:44:06 ]
diclazepam Forma Name 7-chloro-5(2-chlorophenyl)-1,3-dihydro-1-methyl-2H-1,4-benzodiazepin-2-one CAS Number 2894-64-0 Synonyms 2 ’ -Chlorodiazepam Ro 5-3448 Molecular Formula C16H12CI2NN2O Formula Weight 319.2 purity ≥ 98% Formulation A crystalline solid SMILES CIC1=CC(C(C2=C
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:43:08 ]
alprazolam Formal Name 8-Chloro-1-methyl-6-phenyl-4H-[1,2,4]triazolo[4,3-a][1,4]benzodiazepine CAS Number 28981-97-7 Molecular Weight 308.8 Formulation A 1mg/ml solution in methanol SMILES IC1=CC(C(C2=CC=CC=C2)=NC3)=C(C=C1)N4C3=NN=C4C InChI Code InChI=1S/C17H13CIN4/c1-11-20-21-16
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:41:36 ]
etizolam Bioavailability 93% Molar mass 342.07g/mol CAS ID 40054-69-1 Biological half-life 6.2 hours(main metabolite is 8.2 hours) Metabolism Hepatic Formula C17H15ClN4S We are a professional supplier of alprazolam, etizolam, diclazepam, hydrocodone, clonazolam, a-pvp, 2c-b, 3-Me
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:40:11 ]
3-MeO-PCP CAS 91164-58-8 Formula C18H27NO Molecular Weight 273.41 Compound purity>99.7% Appearance power IUPAC 1-[1-(3-methoxyphenyl)cyclohexyl]-piperidine Synonyms 3-Methoxyphencyclidine We are a professional supplier of alprazolam, etizolam, diclazepam, hydrocodone, clonazolam,
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:38:44 ]
Carfentanil Formal Name 4-[(1-oxopropyl)phenylamino]-1-(2-phenylethyl)-4-piperidinecarboxylic acid, methyl ester CAS Number 59708-52-0 Synonyms 4-carbomethoxy Fentanyl Carfentanyl Molecular Formula C24H30N2O3 Formula Weight 394.5 Purity ≥ 95% Formulation A solution in methanol
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:37:03 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We provi
Creative Peptides [2017-10-16 14:12:46 ]
CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on
Creative Peptides [2017-10-16 14:12:09 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ht
Creative Peptides [2017-09-28 16:34:38 ]
We could give you 1. Best quality in your requirement 2. Competitive price in China market 3. mature Technical support 4. Professional logistic support 5 . Full experience of large numbers containers loading in Chinese sea port 6 Fast shipment by reputed shipping line 7. Packing
Qianqiu Biological Technology Co. [2017-09-26 16:01:31 ]
Kigtropin HGH Supplies for Health Providers (Boxes,Vials,Labels). Box Kingtropin Vials Glass Stickers 100 Labels per sheet Other supplies available Hygetropin, Riptropin, Taitropin, Ansomone, Haratropin, Igtropin
The HGH and HCG Company [2017-09-25 22:54:53 ]
Contact pharm@dongruitech com We can offer you the big crystals 4-cmc and many others like the following MDDMPV D1 5F-THJ-018 5F-THJ-2201 3-MMC 4-MEC MAM-2201 MXE MCPP 4-ACO-DMT 4-MEO-PCP 5-MEO-MIPT 4-FA 4-FMA AH-7921 25I- NBOME 25B- NBOME 25C- NBOME 2CE 2CI 5-APB 6-APB Ephedrine
Dongrui Technology Co.,Ltd [2017-09-22 10:53:30 ]
Contact pharm@dongruitech com We can offer you the big crystals 4-cmc and many others like the following Blue color alpha-pvp UR-144 5FUR-144 AKB-48 5FAKB-48 4-CMC A-PVT PV8 A-PVP M11 M1 MDDMPV D1 5F-THJ-018 5F-THJ-2201 3-MMC 4-MEC MAM-2201 MXE 4-ACO-DMT 4-MEO-PCP 5-MEO-MIPT 4-FA
Dongrui Technology Co.,Ltd [2017-09-22 10:51:51 ]
Contact pharm@dongruitech com We can offer you the big crystals 4-cmc and many others like the following Blue color alpha-pvp UR-144 5FUR-144 AKB-48 5FAKB-48 4-CMC A-PVT PV8 A-PVP M11 M1 MDDMPV D1 5F-THJ-018 5F-THJ-2201 3-MMC 4-MEC MAM-2201 MXE MCPP 4-ACO-DMT 4-MEO-PCP 5-MEO-MIPT
Dongrui Technology Co.,Ltd [2017-09-22 10:40:17 ]
Sample At any time to provide (lowest price & highest quality) And you just need pay the freight Please don\'t miss the high quality products. Main products bkebdp 4cec 4cmc mmbc hex We can supply 2.NM2201 3.FUB-AMB 4.ethyl-hexedrone(hex) 5.BK-EBDP (Crystal) 6.ibrutinib 7.Mexedro
Qianqiu Biological Technology Co. [2017-09-20 14:25:31 ]
Email chris@njzcpharma com skype chris_40020 Are you now seaching a trustworthy supplier ? Yes, we are. Choose us, you choose the correct one. we produce the strongest potency Pharmaceutical Intermediates many years. And have a good selling in the world market,mainly North Americ
NanJing ZhongCheng industry co.,ltd. [2017-09-20 13:01:48 ]
Email chris@njzcpharma com skype chris_40020 Are you now seaching a trustworthy supplier ? Yes, we are. Choose us, you choose the correct one. we produce the strongest potency Pharmaceutical Intermediates many years. And have a good selling in the world market,mainly North Americ
NanJing ZhongCheng industry co.,ltd. [2017-09-19 16:55:06 ]
