GLP-2 (rat)

CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on

Creative Peptides      [2017-10-16 14:12:09 ]

APETx2

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ht

Creative Peptides      [2017-09-28 16:34:38 ]

selling bkebdp bkebdp bkebdp bkebdp 4cec mmbc hex felix@scqqbio.com

We could give you 1. Best quality in your requirement 2. Competitive price in China market 3. mature Technical support 4. Professional logistic support 5 . Full experience of large numbers containers loading in Chinese sea port 6 Fast shipment by reputed shipping line 7. Packing

Qianqiu Biological Technology Co.      [2017-09-26 16:01:31 ]

Kigtropin HGH Supplies for Health Providers (Boxes,Vials,Labels)

Kigtropin HGH Supplies for Health Providers (Boxes,Vials,Labels). Box Kingtropin Vials Glass Stickers 100 Labels per sheet Other supplies available Hygetropin, Riptropin, Taitropin, Ansomone, Haratropin, Igtropin

The HGH and HCG Company      [2017-09-25 22:54:53 ]

hexen,bk,ap

Contact pharm@dongruitech com We can offer you the big crystals 4-cmc and many others like the following MDDMPV D1 5F-THJ-018 5F-THJ-2201 3-MMC 4-MEC MAM-2201 MXE MCPP 4-ACO-DMT 4-MEO-PCP 5-MEO-MIPT 4-FA 4-FMA AH-7921 25I- NBOME 25B- NBOME 25C- NBOME 2CE 2CI 5-APB 6-APB Ephedrine

Dongrui Technology Co.,Ltd      [2017-09-22 10:53:30 ]

hexen,bk

Contact pharm@dongruitech com We can offer you the big crystals 4-cmc and many others like the following Blue color alpha-pvp UR-144 5FUR-144 AKB-48 5FAKB-48 4-CMC A-PVT PV8 A-PVP M11 M1 MDDMPV D1 5F-THJ-018 5F-THJ-2201 3-MMC 4-MEC MAM-2201 MXE 4-ACO-DMT 4-MEO-PCP 5-MEO-MIPT 4-FA

Dongrui Technology Co.,Ltd      [2017-09-22 10:51:51 ]

maf,fuf,4-cdc,4cec,4emc,4mec buf,a_ppp,abdf,hexen

Contact pharm@dongruitech com We can offer you the big crystals 4-cmc and many others like the following Blue color alpha-pvp UR-144 5FUR-144 AKB-48 5FAKB-48 4-CMC A-PVT PV8 A-PVP M11 M1 MDDMPV D1 5F-THJ-018 5F-THJ-2201 3-MMC 4-MEC MAM-2201 MXE MCPP 4-ACO-DMT 4-MEO-PCP 5-MEO-MIPT

Dongrui Technology Co.,Ltd      [2017-09-22 10:40:17 ]

4cmc 4cmc 4cmc 4cmc 4cmc 4cmc 4cmc 4cmc felix@scqqbio.com

Sample At any time to provide (lowest price & highest quality) And you just need pay the freight Please don\'t miss the high quality products. Main products bkebdp 4cec 4cmc mmbc hex We can supply 2.NM2201 3.FUB-AMB 4.ethyl-hexedrone(hex) 5.BK-EBDP (Crystal) 6.ibrutinib 7.Mexedro

Qianqiu Biological Technology Co.      [2017-09-20 14:25:31 ]

fub-amb powder

Email chris@njzcpharma com skype chris_40020 Are you now seaching a trustworthy supplier ? Yes, we are. Choose us, you choose the correct one. we produce the strongest potency Pharmaceutical Intermediates many years. And have a good selling in the world market,mainly North Americ

NanJing ZhongCheng industry co.,ltd.      [2017-09-20 13:01:48 ]

bk-ebdp brown crystal China supplier

Email chris@njzcpharma com skype chris_40020 Are you now seaching a trustworthy supplier ? Yes, we are. Choose us, you choose the correct one. we produce the strongest potency Pharmaceutical Intermediates many years. And have a good selling in the world market,mainly North Americ

NanJing ZhongCheng industry co.,ltd.      [2017-09-19 16:55:06 ]

Enobosarm

OSTARINE (MK-2866) Synonyms ( S)-N-(4-cyano-3-(trifluoromethyl)phenyl)-3-(4-cyanophenoxy)-2-hydroxy-2-methylpropanamide CAS NO 1032350-13-2 Molecular Formula C19H14F3N3O3 Molecular weight 480.39 Appearance Powder Detail Enobosarm, also known as ostarine, is an investigational se

Wuhan Fantaike pharmaceutical Technology Co., Ltd.      [2017-09-13 15:23:39 ]

Sell bk-ebdp bkebdp bk crystal dibutylone sales5@kaiwodun-pharma.com

e-mail: sales5@kaiwodun-pharma com skype live sales5_887 We are a professional pharmaceutical intermediates manufacturer with more than ten years experience and we can offer products like 4-cec 4cdc 4emc u47800 bk-ebdp fuef hex-en hexedrone mexedrone Isopropylphenidate akb48ch

Shanghai Kaiwodun Biochemical Co.,Ltd.      [2017-09-13 14:03:57 ]

a ketamine 6740-88-1 C13H16ClNO alprazolam 2fdck maf bk-edbp mdma ketamine China High purity mail/skype:coco(@)peak-bio.com

Ketamine , sold under the brand name Ketalar among others, is a medication Common side effects include psychological reactions as the medication wears off. [22] These reactions may include agitation, confusion, or hallucinations Ketamine was discovered in 1962, first tested in hu

PEAK-BIO CO., LIMITED      [2017-09-05 10:06:25 ]

a etizolam 40054-69-1 C17H15ClN4S alprazolam 2fdck maf bk-edbp mdma ketamine China High purity mail/skype:coco(@)peak-bio.com

Supply Capacity product name Etizolam Appearance powder cas no 101345-66-8 purity 99.9% storage stay in dry, cool and well-sealed Application pharmaceutical intermediate Place of Origin shenzhen Min Order 10 Gram Means of Transport Land, Ocean, Air Production Capacity 500kg/month

PEAK-BIO CO., LIMITED      [2017-09-05 09:27:55 ]

a alprazolam ALPRAZOLAM 28981-97-7 C17H13ClN4 China High purity mail/skype:coco(@)peak-bio.com

Alprazolam , available under the trade name Xanax , is a potent

PEAK-BIO CO., LIMITED      [2017-09-05 09:08:27 ]

a N-Methylcarfentanil mail/skype:coco@peak-bio.com N-Methylcarfentanil 59708-50-8

Product Name N-Methylcarfentanil Email/skype Coco@peak-bio com CAS No 59708-50-8 Molecular Formula C24H26N2O2 IUPAC Methyl (S)-2-[1-(5-fluoropentyl)-1H-indazole-3-carboxamido]-3,3-dimethylbutanoate Description White Powder Package Aluminum Alloy Bag Or According To Request Delive

PEAK-BIO CO., LIMITED      [2017-09-05 09:03:11 ]

Bispecific CSPG4/CD3 antibody

A human melanoma-associated chondroitin sulfate proteoglycan plays a role in stabilizing cell-substratum interactions during early events of melanoma cell spreading on endothelial basement membranes. CSPG4 represents an integral membrane chondroitin sulfate proteoglycan expressed

Creative Biolabs      [2017-08-31 11:15:39 ]

Bispecific GPC3/CD3 antibody

Cell surface heparan sulfate proteoglycans are composed of a membrane-associated protein core substituted with a variable number of heparan sulfate chains. Members of the glypican-related integral membrane proteoglycan family (GRIPS) contain a core protein anchored to the cytopla

Creative Biolabs      [2017-08-31 11:14:57 ]

Bispecific FAP/CD3E antibody

The protein encoded by this gene is a homodimeric integral membrane gelatinase belonging to the serine protease family. It is selectively expressed in reactive stromal fibroblasts of epithelial cancers, granulation tissue of healing wounds, and malignant cells of bone and soft ti

Creative Biolabs      [2017-08-31 11:14:12 ]

New Product MK-677

Product Name MK-677 CAS NO 159752-10-0 Molecular Formula C27H36N4O5S CH4O3S Molecular weight 624.776 Appearance Powder Detail MK-677 also known as Ibutamoren, MK-0677, L-163,191 is a non-peptidic, potent, long-acting, orally-active, and selective agonist of the ghrelin receptor a

Wuhan Fantaike pharmaceutical Technology Co., Ltd.      [2017-08-29 10:10:33 ]