Buy Nandrolone Phenylpropionate NPP Powder from info@goldenraws com Product Name Nandrolone Phenylpropionate powder CAS No 62-90-8 Molecular formula C27H34O3 Molecular weight 406.56 Appearance White powder Assay 99%min Delivery time 5-7 working days door to door Minimum order 10g
GoldenRaws [2017-11-17 15:52:12 ]
Buy Nandrolone Decanoate Deca Durabolin Powder from info@goldenraws com Product Name Nandrolone Decanoate powder CAS No 360-70-3 Molecular formula C28H44O3 Molecular weight 428.65 Appearance light white powder, odourless. Refrigeration preservation Assay 99% min Delivery time 5-7
GoldenRaws [2017-11-17 15:51:07 ]
Buy LGD-3033 New Sarm Powder from info@goldenraws com Product Name LGD-3033 Powder CAS No 917891-35-1 Molecular Formula C16H14ClF3N2O Molecular Weight 342.743 Appearance Off-white fine powder Assay 98%+ Purity Supplier GoldenRaws Effective Dose 20mg split dose every 8-9 hours Sto
GoldenRaws [2017-11-17 15:48:36 ]
Dear purchasing manager, Hi,this is A manda from Shanghai Changhong chemical technology co.,Ltd, we are a specialized exporter of Pharmaceutical Intermediates Al-prazolam Fen tanyl Fen tanyl Ac-id Car-fen-tanyl Bk-md-ma me-thylone Md-pv ap pp fu f 6-a-pb 4-cl pet 4-cl pmt Ab-fu-b
Shanghai Changhong chemical technology c [2017-11-07 15:31:50 ]
Product Description Rapamycin Synonyms 23,27-Epoxy-3H-pyrido[2,1-c][1,4]oxaazacyclohentriacontine; Sirolimus Molecular Formula C51H79NO13 Molecular Weight 914.18 CAS 53123-88-9 Application Rapamycin is a triene macrolide antibiotic, which demonstrates anti-fungal, anti-inflammato
Hunan World Well-Being Bio-tech Co.,Ltd. [2017-10-26 13:58:16 ]
Common names Deschloroketamine, DCK, DXE, O-PCM Substitutive name Deschloroketamine Systematic name 2-Phenyl-2-(methylamino)cyclohexanone Deschloroketamine, or 2-Phenyl-2-(methylamino)cyclohexanone, is classed as an arylcyclohexylamine Descholoroketamine is a chiral molecule a
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:56:09 ]
Flubromazolam 21930924 Chemical Names Flubromazolam; UNII-1BF1HN5GWD; 1BF1HN5GWD; 612526-40-6; 8-bromo-6-(2-fluorophenyl)-1-methyl-4H-[1,2,4]triazolo[4,3-a][1,4]benzodiazepine; SCHEMBL2841164 Molecular Formula Molecular Weight 371.213 g/mol InChI Key VXGSZBZQCBNUIP-UHFFFAOYSA-N
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:53:39 ]
PubChem CID 3033985 Chemical Names Meclonazepam; UNII-RN43209SMA; 58662-84-3; RN43209SMA; Meclonazepamum; (3S)-5-(2-chlorophenyl)-3-methyl-7-nitro-1,3-dihydro-1,4-benzodiazepin-2-one Molecular Formula C16H12ClN3O3 Molecular Weight 329.74 g/mol InChI Key LMUVYJCAFWGNSY-VIFPVBQESA-
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:51:59 ]
Molecular Formula C10H14BrNO2 IUPAC Molar mass 260.13 g/mol 2C-B is a psychedelic drug. It was first synthesized by Alexander Shulgin in 1974. In Shulgin\'s book PiHKAL, the dosage range is listed as 12–24 mg. 2C-B is sold as a white powder sometimes pressed in tablets or gel
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:46:51 ]
A-PVP Synonyms A-pvp 2-(1-pyrrolidinyl)-Valerophenone O-2387 Formal Name 1-phenyl-2-(1-pyrrolidinyl)-1-pentanone, monohydrochloride CAS Number 5485-65-4 Molecular Formula C15H21NO • HCl Formula Weight 267.8 Formulation A crystalline solid We are a pro
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:45:57 ]
clonazolam Clonazolam (also known as clonitrazolam) is a benzodiazepine that has been sold online as a designer drug. Systematic (IUPAC) name 6-(2-chlorophenyl)-1-methyl-8-nitro-4H-[1,2,4]triazolo[4,3-a][1,4]benzodiazepine CAS Number 33887-02-4 Chemical data Formula C17H12ClN5
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:45:04 ]
hydrocarbon e Hydrocodone is a semi-synthetic opioid derived from codeine. Hydrocodone is used orally as a narcotic analgesic and antitussive, often in combination with paracetamol or ibuprofen. We are a professional supplier of alprazolam, etizolam, diclazepam, hydrocodone, clon
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:44:06 ]
diclazepam Forma Name 7-chloro-5(2-chlorophenyl)-1,3-dihydro-1-methyl-2H-1,4-benzodiazepin-2-one CAS Number 2894-64-0 Synonyms 2 ’ -Chlorodiazepam Ro 5-3448 Molecular Formula C16H12CI2NN2O Formula Weight 319.2 purity ≥ 98% Formulation A crystalline solid SMILES CIC1=CC(C(C2=C
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:43:08 ]
alprazolam Formal Name 8-Chloro-1-methyl-6-phenyl-4H-[1,2,4]triazolo[4,3-a][1,4]benzodiazepine CAS Number 28981-97-7 Molecular Weight 308.8 Formulation A 1mg/ml solution in methanol SMILES IC1=CC(C(C2=CC=CC=C2)=NC3)=C(C=C1)N4C3=NN=C4C InChI Code InChI=1S/C17H13CIN4/c1-11-20-21-16
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:41:36 ]
etizolam Bioavailability 93% Molar mass 342.07g/mol CAS ID 40054-69-1 Biological half-life 6.2 hours(main metabolite is 8.2 hours) Metabolism Hepatic Formula C17H15ClN4S We are a professional supplier of alprazolam, etizolam, diclazepam, hydrocodone, clonazolam, a-pvp, 2c-b, 3-Me
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:40:11 ]
3-MeO-PCP CAS 91164-58-8 Formula C18H27NO Molecular Weight 273.41 Compound purity>99.7% Appearance power IUPAC 1-[1-(3-methoxyphenyl)cyclohexyl]-piperidine Synonyms 3-Methoxyphencyclidine We are a professional supplier of alprazolam, etizolam, diclazepam, hydrocodone, clonazolam,
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:38:44 ]
Carfentanil Formal Name 4-[(1-oxopropyl)phenylamino]-1-(2-phenylethyl)-4-piperidinecarboxylic acid, methyl ester CAS Number 59708-52-0 Synonyms 4-carbomethoxy Fentanyl Carfentanyl Molecular Formula C24H30N2O3 Formula Weight 394.5 Purity ≥ 95% Formulation A solution in methanol
Wuhan Tuoke Biotechnology Co.,Ltd [2017-10-18 13:37:03 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We provi
Creative Peptides [2017-10-16 14:12:46 ]
CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on
Creative Peptides [2017-10-16 14:12:09 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ht
Creative Peptides [2017-09-28 16:34:38 ]