products food - Manufacturers, Suppliers & Exporters
melamine kid\'s cup . Product size D7.2*H10cm Product Weight 65g 260ml Material 100% melamine or 30% melamine Packaging Details 1) General Packing Bulk Packing. 2) As customers required. Delivery Time Shipped in 30--40 days after payment. 3.MOQ 3000pcs/design Customized 1)OEM &
QuanZhou PingHui Melamine Products Co.,Ltd [2017-12-11 16:14:10 ]
Specification - Food grade - Medical grade - High tear strengt h - Fast curing time - High translucent Application of Medical Grade liquid silicone rubber for shoe insoles The product is a two component high elongation silicone gel designed for silicon e food care products, such
深圳红叶公司 [2014-08-04 03:53:21 ]
Have you ever eaten at a sushi restaurant with imitation crab shredded? Our shredded crab meat is produced on the basis of an imitation crab stick that cooled. According to our factory\'s strict production requirements, all shredded imitation crab meat has to pass strict inspecti
SHANDONG MEIJIA GROUP CO., LTD. [2023-01-12 14:58:30 ]
TH non woven bags manufacturer , pp woven bags manufacturer , custom non woven bags . China non woven bags manufacturer,suppliers,custom made cheap personalized non woven bags….. often buy breakfast, cooked food packaging plastic vest bags will be used, there are many businesse
TH Non Woven Bags Manufacturer [2014-07-13 21:26:26 ]
Maolin is one of the acrylic furniture manufacturers in China, our custom acrylic furniture can be customized in bulk. If you are interested and obssesive to clear acrylic lucite furniture, acrylic furniture manufacturers will bring you so many happy moments to your life. Lucite
ningbo maolin plastic technology co.,ltd. [2023-02-20 10:33:37 ]
Product Information Other name Tranexamic acid, 4- (Aminomethyl) Cyclohexanecarboxylic Acid ; transamin CAS No. 1197-18-8 Molecular Formula C8H15NO2 Molecular Weight 157.21 EINECS No. 214-818-2 Source Synthetic Appearance White powder Assay ≥ 99.0% Product Description Tra
HN Langyue Biotech Co Ltd [2021-06-15 16:20:03 ]
Perforated Tubes are popularly used in filter products as support tubing, and sometimes it is used directly as filter tubes and cylinders for certain industries. We supply perforated tubes to support the filter media in making of various filter elements. Using of perforated metal
Victall Perforated Tubing Co [2022-01-04 15:14:49 ]
Model AMS-300/AMSQP-500 Capacity 300-500kg/h Power source 0.75kw/1.1kw Dimensions 540*820*1060mm/970*700*1040mm Guarantee 2 years Delivery time 10-15 days Pueraria Slicing Machine Introduction The pueraria slicing machine is used for slicing cultured pueraria and wild pueraria, e
Zhengzhou Amisy Trading Co.,Ltd [2017-08-11 14:51:01 ]
scales which often appear in the hot-rolled process. The surface quality is excellent, with smooth finish. In addition, the dimensional accuracy of cold-rolled products is high, and the product performances and organization can meet some special requirements, such as, electromagn
Shandong Tangrong steel import and Export Trading Co., Ltd [2015-11-07 15:15:55 ]
Usage Butyl cinnamate i s naturally present in kumquat. It has sweet fruit and balsamic scent, similar to spicy spices, creamy amber aroma with cocoa beans and fruity notes. The ta ste is characterized by aroma and fruity aroma, similar to the sweet taste of red currant. It is of
Landmark industrial [2020-01-16 16:36:53 ]
Types of Thermistor FunctionThere are two main types of thermistors NTC and PTC thermistors. Although these two are made of different materials, both can respond to temperature changes in a specific ... Temperature Sensor For Home Appliance For Pellet Grill For Food For Instrumen
Shenzhen Temp-sen sensor Co., LTD [2022-11-23 16:08:00 ]
CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on
Creative Peptides [2017-10-16 14:12:09 ]
Material PET/ PP/PVC Dimension 350 250 50mm Color As custom Gram weight 35g Feature durable, colorful, convenient, recyclable, environmental friendly, waterproof Advantage 1.help to enhance product image 2.make product attractive and impressive 3.help to promote product sales Qua
Shijiazhuang Gaocheng Heli Plastic Co., LTD [2015-07-09 16:48:21 ]
Explosion proof handphone by increasing protection circuit, shielding and packaging components, using special material shell and other measures to ensure that mobile phone will not become ignition source, so intrinsically safe smart phone ensure the safety of users in inflammable
Sichuan Xuxin Technology Co., LTD [2023-08-04 11:37:28 ]
MEDECO Portable Refrigerator Model MELCX-6L Features 1. Made of environmental PP material, food grade and non-toxic. 2. Insulation material is PU CFC-free polyurethane. 3. The storage container can keep content cooling up to 24 hours. 4. Storage container is durable for vaccine s
SHANGHAI MEDECO INDUSTRY CO.,LTD. [2019-08-26 09:31:47 ]
Siansonic unique non-invasive ultrasonic air bubble detectors and ultrasonic air bubble sensors are widely used in the detection of air bubbles in liquid delivery for medical industry such as infusion pumps, dialysis machines and in vitro diagnostic instruments. Ultrasonic air bu
Siansonic Technology Ltd [2023-06-05 16:33:26 ]
Model AMS80/AMS120 Capacity 4800/7200 pcs/h Power source 1.5/2.2KW Dimensions 670*420*730/ 990*470*1150 mm Guarantee 1 year guarantee Delivery time 5-10 days Automatic Dumpling /Samosa Machine Introduction The dumpling machines are widely used in dumpling processing plant, guesth
Zhengzhou Amisy Trading Co.,Ltd [2017-09-19 09:59:50 ]
MstnLand, as a professional cast iron gate valves suppliers, provides high performance gate valve products, mainly include bolted bonnet wedge gate valves and pressure seal bonnet gate valves, which are widely used in gas, petrochemical, oil, offshore, power station and refining
MSTN International Technologies Company [2023-03-20 14:01:32 ]
Aircraft Atlas Aluminum Oven Rack Specifications Title： Atlas KSSU aluminum alloy airline oven insert galley oven rack Product Name： airline oven rack, oven insert Application For airline flight attendants use, food carrier Material： Aluminum alloy Size： 387*225*414 mm We
Guangxi Nanning Flight Supply Trading Co., Ltd. [2022-05-17 11:33:32 ]
1.Material HDPE or LDPE,100%virgin or recycled material. 2.Feature Reusable,Leakproof,Biodegaradable. 3.Usage food,garbage,trash,rubbish,packaging. 4.Range of application home, school,hospital,restaurant,hotel,supermakert,park and so on. 5.Specifications size ,thickness,printing,
Changle FengRui packaging products Co.Ltd [2019-05-28 10:39:39 ]
