P-type and Q-type Ca2+ channels, ω-Agatoxin TK is an antagonist of voltage-sensitive P-type Ca2+ channels1 
  
 
  SPECIFICATION OF Ω AGATOXIN IVB 
  CAT C1060-V 
  CAS NO. 158484-42-5 
  Product Name ω agatoxin IVB 
  Purity > 98% 
  Form/State Lyophilized powder 
  Solubility Water, or 0.9% NaCl solution 
  Molecular weight 5273 Da 
  Molecular formula C215H337N65O70S10 
  Source Synthetic peptide 
  Storage Shipped at room temperature. The product, as supplied, can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C. 
  Storage of solutions Up to two weeks at 4°C or three months at -20°C. 
  Sequence EDNCIAEDYGKCTWGGTKCCRGRPCRCSMIGTNCECTPRLIMEGLSFA(Disulfide bonds between Cys4-Cys20, Cys12-Cys25, Cys19-Cys36, and Cys27-Cys34. D-Ser46) 
  
 
  APPLICATION OF Ω AGATOXIN IVB 
  ω-agatoxin IVB antagonist of voltage-activated calcium channels was purified from the venom of the funnel-web spider, Agelenopsis aperta. This 48-amino acid peptide, omega-agatoxin (omega-Aga)-IVB, was found to be a potent blocker of P-type calcium channels 
  
 
  As one of the professional custom peptide pharmaceutical companies in China, KS-V Peptide has been specialized in providing customized synthesis services of difficult peptides, including Toxins and Analogues, Ubiquitins and Ubiquitin Probes, Post-translational Histones and other peptide manufacturing, APIs and process optimization of the pharmaceutical peptide. 
  
 
  If you want to know more about modification of histones, please visit our website.