Good Quality 3-FPM 3-FPM 3fpm 3FPM 3fpm Email:lily@tkbiotechnology.com,whatsapp:+8613001881974

We offer high quality Research Chemicals Transportation: DHL,FEDEX,UPS.EMS hot selling research chemicals: 5F-PCN 5F-NNEI(5F-MN24) 2nmc 4cmc 4cpvpapvp Dibutylone Adrafinil 4FPHP 5-MEO-NEPTmipt,dmt mphp BB22 ADB-CHMINACA MAB-CHMINACA FUB-AKB48 SDb005 NM2201 MMB2201 ro-8 ...

Wuhan Tuoke Biotechnology Co.Ltd.    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-19 07:11:08 ]

Dynamin inhibitory peptide

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 06:25:35 ]

Dynamin inhibitory peptide, myristoylated

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 06:23:37 ]

Bax inhibitor peptide, negative control

Creative Peptides is staffed by scientific teams with experts in the field of peptide technology, antibodies and synthetic chemistry. Our extensive expertise is translated into high quality products and world-class services to ensure the maximum satisfaction of the customs. ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 06:23:10 ]

cGMP Dependent Kinase Inhibitor Peptide

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 06:21:07 ]

Autocamtide-2-related inhibitory peptide, myristoylated

M.W/Mr.1708.12 Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 06:18:15 ]

Rac1 Inhibitor F56, control peptide

We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We provide Rac1 Inhibitor F56, control peptide. Sequence MVDGKPVNLGLFDTAG M.W/Mr.1632.89 Molecular ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 06:16:28 ]

Lyn peptide inhibitor

We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 06:14:40 ]

Phospho-Glycogen Synthase Peptide-2 (substrate)

We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Synonyms/Alias GS peptide-2 CAS No. 851366-97-7 Sequence YRRAAVPPSPSLSRHSSPHQSEDEEE (Modifications: Ser-21 = ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 06:13:43 ]

Motilin (human, porcine)

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 06:12:46 ]

GLP-2 (rat)

CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M.W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 06:12:09 ]

pep4c

Sequence KRMKVAKSAQ M.W/Mr. 1146.42 Molecular Formula C48H91N17O13S Storage -20°C Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 06:10:18 ]

pep2-SVKE

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 06:08:21 ]

Pep1-AGL

We provide Pep1-AGL. More information please visit our website: https://www.creative-peptides.com/product/pep1-agl-item-r0833-34635.html CAT#R0833 SequenceSSGMPLGAAGL M.W/Mr.960.11 Molecular FormulaC40H69N11O14S Storage-20°C Creative Peptides is specialized in the process ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 06:05:57 ]

Retrobradykinin

We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAT# R0832 CAS No. 5991-13-9 Sequence RFPSFGPPR M.W/Mr. 1060.22 Molecular Formula C50H73N15O11 Storage -20°C ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 06:04:11 ]

Bombinakinin-GAP

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 06:03:19 ]

apoE(133-149)

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAS ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 06:02:26 ]

GR 231118

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 06:01:32 ]

BIM 23056

CAS No.150155-61-6 SequenceFFYWKVFX (Modifications: Phe-1 = D-Phe, Trp-4 = D-Trp, X = D-Nal & C-terminal amide) M.W/Mr.1232.49 We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 05:59:23 ]

NTR 368

CAT#R0825 Synonyms/Alias Neurotrophin receptor (368-381) amideCAS No.197230-90-3SequenceATLDALLAALRRIQ-amide (Modifications: Ala-1 = N-terminal Ac, Gln-14 = C-terminal amide) M.W/Mr.1565.87 Molecular FormulaC69H124N22O19 Storage-20°C Creative Peptides is specialized in the ...

Creative Peptides    [Chemicals]   [Pharmaceutical Chemicals]   [2017-10-16 05:55:43 ]