Dexamethasone

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Dexamethasone Another Name 9-alpha-fluoro-11-beta,17-alpha,21-trihydroxy-16-alpha-methylpregna-1,4-diene-3,20-dione; 9-alpha-fluoro-16-alpha-methylprednisolone; 9alpha-Fluoro-11beta,17alpha,

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:48:30 ]

Deslorelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Deslorelin Synonyms GLP-HIS-TRP-SER-TYR-D-TRP-LEU-ARG-PRO-NHET;[D-TRP6, DES-GLY10]-LH-RH ETHYLAMIDE;DESORELIN;DESLORELIN;deslorelin acetate;DESLORELIN (HUMAN);DES-GLY10,[D-TRP6]

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:43:06 ]

Adipotide

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Quick Detail Adipotide Sequence CKGGRAKDC-GG-D(KLAKLAK)2 Peptide Sequence ys-Lys-Gly-Gly-Arg-Ala-Lys-Asp-Cys-Gly-Gly{D-Lys}-{D-Leu}-{D-Ala}-{D-Lys}-{D-Leu}-{D-Ala}-{D-Lys}-{D-Lys}-{D-Leu}-{D

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:28:52 ]

Eptifibatide

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Eptifibatide Sequence Mpr-Har-Gly-Asp-Trp-Pro-Cys-NH2 Cas No. 148031-34-9 Molecular Formula C35H49N11O9S2 Molecular Weight 832.4 Specific Rotation[20/D] -75.0~-95.0°(C=1,1%HAc) Amin

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:26:11 ]

Follistatin 344

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Follistatin hghsalehumanstech(at)gmail dot com 295,315,317,344 amino acids of the protein. FST(Recombinant Human Follistatin) Period in infants and children, continued growth of muscle, hard

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:20:24 ]

Selank

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Selank is Sterile filtered white lyophilized (freeze-dried) powder Selank is presented in the form of lyophilized powder; that is, a powder that has been freeze-dried. In terms of solubility

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:17:37 ]

Tesamorelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Egrifta(tesamorelin) Sequence H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH Cas No. 106612-94-6 Purity (HPL

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:09:58 ]

Triptorelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Triptorelin introductions Appearance White powder Solubility Soluble in water or 1% acetic acid at a concentration of 1mg/ml to give a clear, colorless solution Identity by HPLC The retentio

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:04:51 ]

HGH Fragment (176-191)

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Growth Hormone peptide fragment 176-191, also known as HGH Frag 176-191, is a modified form of amino acids 176-191 of the GH polypeptide. Investigators at Monash University discovered that t

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:02:01 ]

Pentadecapeptide BPC 157

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com pentadecapeptide BPC 157 Alias Booly Protection Compound 15, Pentadecapeptide, BPC 157 CAS 137525-51-0 Sequence Gly-Glu-Pro-Pro-Pro-Gly- Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val MF C62H98N16O22 M

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:00:49 ]

TB-500

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com TB-500 is a peptide fragment hormone that is primarily used in the treatment of various muscle injuries or pain caused by inflammation. There is very little official human data available for

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:59:39 ]

Oxytocin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Formula C43H66N12O12S2 Synonyms 3-Isoleucine-8-leucine vasopressin;Alpha-hypophamine;Atonin O;Di-sipidin;Endopituitrina;Hyphotocin;Intertocine S;Nobitocin S;Orasthin;Partocon;Perlacton;Pitoc

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:58:55 ]

Sermorelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-G

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:58:01 ]

Hexarelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Hexarelin Synonyms HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE RELEASING HEXAPEPTIDE;Examorelin;Hexareline;L-Histidyl-2-methyl

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:55:45 ]

Ipamorelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Ipamorelin Sequence Aib-His-D-2-Nal-D-Phe-Lys-NH2 Cas No. 170851-70-4 Purity (HPLC) 98.0% Molecular Formula C38H49N905 Molecular Weight 712.03 Single Impurity (HPLC) 0.5%max Amino Acid Compo

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:54:53 ]

GHRP-2

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Quick Detail Product Name GHRP-2 Growth Hormone Releasing Peptide 2 GHRP Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular formula C45H55N9O6 Molar Mass 817.9 CAS number 158861-67-7 P

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:36:57 ]

Melanotan 2

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com MT-2 Product Name Melanotan II, MT- II split into vivals, MT2 supplier, Melanotan II manufacturer MT2 Another Name Melanotan II; AC-NLE-CYCLO(-BETA-ASP-HIS-D-PHE-ARG-TRP-EPSILON-LYS-NH2); Me

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:35:57 ]

CJC-1295

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com CJC-1295 Alias CJC-1295 Acetate; CJC1295(Without DAC); Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys (Mal

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:28:33 ]

CJC-1295 DAC

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com CJC-1295 DAC (Drug Affinity Complex) Alias CJC1295(GHRH/DAC) Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Ly

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:27:44 ]

Pregabalin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Pregabalin CAS 148553-50-8 MF C8H17NO2 MW 159.23 mp 194-196°C storage temp. Store at RT Chemical Properties Off-White Solid Usage S-Enantiomer of Pregabalin. A GABA analogue used as an anti

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:20:21 ]