Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com pentadecapeptide BPC 157 Alias Booly Protection Compound 15, Pentadecapeptide, BPC 157 CAS 137525-51-0 Sequence Gly-Glu-Pro-Pro-Pro-Gly- Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val MF C62H98N16O22 M
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:00:49 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com TB-500 is a peptide fragment hormone that is primarily used in the treatment of various muscle injuries or pain caused by inflammation. There is very little official human data available for
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:59:39 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Formula C43H66N12O12S2 Synonyms 3-Isoleucine-8-leucine vasopressin;Alpha-hypophamine;Atonin O;Di-sipidin;Endopituitrina;Hyphotocin;Intertocine S;Nobitocin S;Orasthin;Partocon;Perlacton;Pitoc
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:58:55 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-G
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:58:01 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Hexarelin Synonyms HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE RELEASING HEXAPEPTIDE;Examorelin;Hexareline;L-Histidyl-2-methyl
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:55:45 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Ipamorelin Sequence Aib-His-D-2-Nal-D-Phe-Lys-NH2 Cas No. 170851-70-4 Purity (HPLC) 98.0% Molecular Formula C38H49N905 Molecular Weight 712.03 Single Impurity (HPLC) 0.5%max Amino Acid Compo
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:54:53 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Quick Detail Product Name GHRP-2 Growth Hormone Releasing Peptide 2 GHRP Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular formula C45H55N9O6 Molar Mass 817.9 CAS number 158861-67-7 P
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:36:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com MT-2 Product Name Melanotan II, MT- II split into vivals, MT2 supplier, Melanotan II manufacturer MT2 Another Name Melanotan II; AC-NLE-CYCLO(-BETA-ASP-HIS-D-PHE-ARG-TRP-EPSILON-LYS-NH2); Me
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:35:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com CJC-1295 Alias CJC-1295 Acetate; CJC1295(Without DAC); Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys (Mal
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:28:33 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com CJC-1295 DAC (Drug Affinity Complex) Alias CJC1295(GHRH/DAC) Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Ly
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:27:44 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Pregabalin CAS 148553-50-8 MF C8H17NO2 MW 159.23 mp 194-196°C storage temp. Store at RT Chemical Properties Off-White Solid Usage S-Enantiomer of Pregabalin. A GABA analogue used as an anti
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:20:21 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Articaine hydrochloride Alias Articaine HCl CAS 23964-57-0 EINECS 245-957-7 M F. C13H20N2O3S ClH M W. 320.839 M S. Usage:Anesthetic;Na+ channel inhibitor. Articaine hydrochloride Alias A
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 10:17:34 ]
Nandrolone laurate Email angel(at)health-gym(dot)com Skype live angel_11616 CAS 26490-31-3 EIENCS 247-739-7 MF C30H48O3 MW 456.7 Assay 99% min. Packing foil bag or tin. Delivery Express courier. Usage pharmaceutical material, Tibolone intermediate. Standard Enterprise standard Do
HK Globle Sino Ocean Dev. Co., Limited [2016-12-10 09:28:37 ]
Nandrolone cypionate Email angel(at)health-gym(dot)com Skype live angel_11616 CAS 601-63-8 EIENCS 210-006-7 MF C26H38O3 MW 398.57812 Specification 200mg/ml Packing 1kg net/ plastic bottle or tin.. Standard Enterprise standard Delivery Express courier. Appearance yellow liquids Us
HK Globle Sino Ocean Dev. Co., Limited [2016-12-10 09:26:43 ]
Dehydronandrolon acetate Email angel(at)health-gym(dot)com Skype live angel_11616 Other name Dehydronandrolon; Dehydronandrolone-6 Acetate; 6-Dehydronandrolone acetate CAS 2590-41-2 Molecular formula C20H26O3 Molecular weight 314.42 Assay 98% Storage Controlled Substance, -20ºCF
HK Globle Sino Ocean Dev. Co., Limited [2016-12-10 09:25:57 ]
Mestanolone Email angel(at)health-gym(dot)com Skype live angel_11616 CAS NO. 521-11-9 EINECS 208-302-6 Assay 99% Molecular Formula C20H32O2 Molecular Weight 304.47 Melting point 224-226°C Packing 1kg/tin/foil bag Appearance White or Similar crystalline powder Soluble in acetone,
HK Globle Sino Ocean Dev. Co., Limited [2016-12-10 09:17:28 ]
Methyltestosterone (17-Alpha-Methyl-Testosterone) Email angel(at)health-gym(dot)com Skype live angel_11616 CAS 65-04-3 EINECS 200-366-3 Assay 99% min. Grade Pharmaceutical Grade Delivery time within 12 hours upon receipt of payment Delivery EMS, DHL, TNT, FedEx, UPS Delivery sa
HK Globle Sino Ocean Dev. Co., Limited [2016-12-10 09:13:22 ]
Testosterone propionate Email angel(at)health-gym(dot)com Skype live angel_11616 CAS 57-85-2 EINECS 200-351-1 Assay 98% min. Molecular Formula C22H32O3 Molecular weight 344.49 Packing diversiform Character White crystalline powder. Delivery safe & timely, around 5-7 business days
HK Globle Sino Ocean Dev. Co., Limited [2016-12-10 09:10:12 ]
Testosterone cypionate Email angel(at)health-gym(dot)com Skype live angel_11616 CAS No 58-20-8 Molecular formula C27H40O3 Molecular weight 412.61 Assay 99% min Appearance white crystalline powder Quality standard USP32 Effective Dose (Men) 300-2000mg+ week Payment method Western
HK Globle Sino Ocean Dev. Co., Limited [2016-12-09 19:43:02 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Synonyms 2-(Diethylamino)ethyl p-aminobenzoate;2-(diethylamino)ethylp-aminobenzoate;2-diethylaminoethyl4-aminobenzoate;2-Diethylaminoethylester kyseliny p-aminobenzoove CAS 59-46-1 Appearanc
Guangzhou Kafen Biotech Co.,Ltd [2016-12-09 16:14:53 ]