Extracorporeal Shock Wave Therapy SW9 Technical Specs Power 500VA(max) LCD touchscreen 8-inch Bullet lifetime over 3 million shocks N W.(device only) 23kg Application pressure 1-4 bar continuously adjustable via touch screen Dimension(with trolley) 53*53*96cm Shock frequency 1-21
iTech Aesthetics Limited [2017-10-17 13:45:11 ]
Shockwave Therapy Machine / SW8 Shock wave work therapy A shockwave is defined as a wave with a rapid increase of pressure within a very short time and then having a gradual decrease of pressure with a small negative pressure phase. Shockwave is aimed at the affected areas that a
iTech Aesthetics Limited [2017-10-17 13:43:25 ]
Radial Shockwave Therapy Extracorporeal Shock Wave Therapy ESWT Treatment for Heel Spurs & Back Pain Shockwave Therapy Shockwave therapy is a multidisciplinary device used in orthopaedics, physiotherapy, sports medicine, urology and veterinary medicine. Its main assets are fast p
iTech Aesthetics Limited [2017-10-17 13:41:56 ]
Body Composition Analyzer Body Fat Analyzer (GS6.5B) 1). About this body composition analyzer Human body elements analyse instrument can detect various elements of human body and analyse human health status, which applies the accurate measurement of AVR micro computer controller,
iTech Aesthetics Limited [2017-10-17 13:40:13 ]
Body fat analyzer and height measuring GS6.6 Body fat analyzer and height measuring equipment, applies the accurate measurement of AVR micro computer controller, bases on new statistics method DXA, analysis human elements fat weight BMI(body mass index), non-fat and other health
iTech Aesthetics Limited [2017-10-17 13:38:23 ]
Cryotherapy Freezefat Coolsculpting Cryolipolysis Machine With 3 Handles Weight Loss Slimming Salon Beauty Equipment 1.Product Pictures WORKING PRINCIPAL-------- Cryolipolysis cool shape machine is a new, non-invasive way to gently and effectively reduce fat in targeted areas of
iTech Aesthetics Limited [2017-10-17 12:05:11 ]
Cryolipolysis Coolsculpting Cooling With 4 Handles Fat Freezing Beauty Machine For Slimming 1.Product description Cryolipolysis cool shape machine is a new, noninvasive way to gently and effectively reduce fat in targeted areas of the body that results in a noticeable, naturalloo
iTech Aesthetics Limited [2017-10-17 12:00:22 ]
Creative Peptides offers HLA-A_24_02 HBV pol tetramer-KYTSFPWLL-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-hbv-pol-tetramer-kytsfpwll-apc-labeled-item-cpm-1-0033-33873.html for more informa
Creative Peptides [2017-10-16 14:25:35 ]
Creative Peptides offers H-2Db human gp100 tetramer-KVPRNQDWL-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/h-2db-human-gp100-tetramer-kvprnqdwl-apc-labeled-item-cpm-1-0034-33874.html for more infor
Creative Peptides [2017-10-16 14:24:26 ]
Creative Peptides offers HLA-A_01_01 CMV pp50 tetramer-VTEHDTLLY-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-cmv-pp50-tetramer-vtehdtlly-apc-labeled-item-cpm-1-0035-33875.html for more infor
Creative Peptides [2017-10-16 14:23:37 ]
Creative Peptides offers HLA-A_24_02 hTERT tetramer-VYGFVRACL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-htert-tetramer-vygfvracl-pe-labeled-item-cpm-1-0036-33876.html for more information.
Creative Peptides [2017-10-16 14:23:10 ]
Creative Peptides offers HLA-E_01_03 HLA-A leader3-11 tetramer-VMAPRTLVL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-e-hla-a-leader3-tetramer-vmaprtlvl-pe-labeled-item-cpm-1-0037-33877.html for
Creative Peptides [2017-10-16 14:21:07 ]
Creative Peptides offers HLA-A_11_01 EBV EBNA3B 416-424 tetramer-IVTDFSVIK-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-ebv-ebna3b-tetramer-ivtdfsvik-pe-labeled-item-cpm-1-0038-33878.html for
Creative Peptides [2017-10-16 14:20:40 ]
Creative Peptides offers H-2Ld HBsAg tetramer-IPQSLDSWWTSL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/h-2ld-hbsag-tetramer-ipqsldswwtsl-pe-labeled-item-cpm-1-0039-33879.html for more information.
Creative Peptides [2017-10-16 14:18:15 ]
Creative Peptides offers HLA-A_11_01 CMV pp65 tetramer-ATVQGQNLK-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-cmv-pp65-tetramer-atvqgqnlk-pe-labeled-item-cpm-1-0040-33880.html for more informa
Creative Peptides [2017-10-16 14:16:28 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We provi
Creative Peptides [2017-10-16 14:12:46 ]
CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on
Creative Peptides [2017-10-16 14:12:09 ]
Model No. G65 Product feature 1) Trays for clean instruments 2) Medical bottles 3) 1 suction gun 4) Illuminating light 5) A secretion canister 6) Endoscope heater 7) Integrated LED cold light source 8) Used instruments and medical waste storage 9) Medication sprayers, insufflatio
Foshan Jialianda Medical Apparatus Co. Ltd. [2017-10-14 16:28:27 ]
For Orthodontic professional use only. Features - 1. Variable force. 2. Stainless steel eyelets allow an easy engagement of various hooks. 3. Special retention system help to keep them attached under the most severe conditions. If you are an Orthodontic Ligature wire
SINO ORTHO LIMITED [2017-09-29 23:27:42 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ht
Creative Peptides [2017-09-28 16:34:38 ]
