growth hormone - Manufacturers, Suppliers & Exporters
Sermorelin, 2mg/vial Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-AR
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:23:18 ]
Alpha-glycerophosphocholine （ Alpha-GPC ） Product Name ： Alpha-GPC Introduction Alpha-glycerophosphocholine (Alpha-GPC or α-GPC) is a cholinergic compound that is used for its cognitive-promoting properties, and to enhance power output in athletes. It appears to also suppo
Wuxi Cima Science [2016-04-25 15:01:12 ]
Type Wolfberry extract Form Powder Part Fruit Extraction Type Solvent Extraction Packaging Drum Place of Origin Shaanxi, China (Mainland) Grade Grade A Brand Name Guoshengherb Model Number Guoshengherb Appearance Brown Yellow Powder Specification 100% natural Certificate ISO9001/
Ningshan Guosheng Biological Technology co.,Ltd [2019-01-31 14:50:35 ]
Introduction Kigtropin HGH is a Human Growth Hormone (hGH) Somatropin produced with recombinant DNA technology identical to the body naturally produced HGH. Following are the reported benefits of use of Kigtropin HGH · Losing Cellulite and Wrinkles · Gaining muscle / losing fat
Hongkong Green Sci Biotech CO. Ltd [2015-09-28 15:19:27 ]
Alpha-glycerophosphocholine（Alpha-GPC） Product Name：Alpha-GPC Introduction Alpha-glycerophosphocholine (Alpha-GPC or α-GPC) is a cholinergic compound that is used for its cognitive-promoting properties, and to enhance power output in athletes. It appears to also support ce
Wuxi Cima Science [2016-04-28 13:05:15 ]
About Us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,
Hongkong Green Sci Biotech CO. Ltd [2015-09-28 15:25:57 ]
CJC-1295 DAC Increase GH Production Intramuscular Injection CJC-1295 For more details Plz contact lmy@ycphar com Skype miss littlemegan Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-LysLys(Maleimidop
Tai'an City Jia biotechnology industry Co.Ltd [2016-10-17 15:23:54 ]
L(-)-Epinephrine Basic Info. Model NO. 51-43-4 CAS 51-43-4Purity 99% Min. Appearance Powder Molecular Formula C9h13no3Molecular Weight 183.2 Einecs 200-098-7 Export Markets GlobalAdditional Info. Packing Disguised Package Standard 99% min. Origin China HS Code 3001901000 Producti
Xiangtan Jiayeyuan Biological Technology Co., Ltd [2018-01-24 11:57:02 ]
1. Introduction Safflower seed oil is obtained from high quality safflower ( Carthamus tinctorius) seeds by cold pressing, which is one of the nature’s most valuable vegetable oils due to its unique fatty acid composition. It provides a high concentration of essential unsaturat
Hangzhou Choisun Bio-tech Co.,LTD [2020-06-10 15:46:43 ]
Testosterone powder for sale at wholesale price Why buy steroids from us? Fast Delivery, Lowest Price, Best Quality! Product name Testosterone Key words Testosterone,Testosterone,Testosterone,Testosterone Base,Testosterone powder Synonym Android;testred;testex;testoderm Testoster
Shenzhen Shijingu Technology Co., Ltd [2014-08-11 04:04:50 ]
L-Glutamine CAS 56-85-9 Molecular Formula C5H10N2O3 Molecular Weight 146.15 Molecular Structure Characteristics White crystalline powder with barely perceptile out and acid taste. Solubility soluble in hot water, slightly soluble in water, practically insoluble in ethanol、aceto
Guangzhou Huao Chemical CO.,Ltd [2016-08-15 08:58:55 ]
This is International Sales Lily with Higher BEC ,TEM8certificates Please believe that I can offer you best price,professional service,fast delivery ans safe custom. Quick Detail Product name Estradiol benzoate CAS No. 50-50-0 M F. C25H28O3 M W. 376.49 Assays 99.09% Packing 5kg/t
广州市虎傲公司 [2015-11-10 11:32:33 ]
Sensitive skin is characterized by symptoms of discomfort when exposed to environmental factors. Peptides are used in cosmetics for sensitive skin and stand out as active ingredients for their ability to interact with skin cells by multiple mechanisms, high potency at a low dosag
Zhuhai Gene-Biocon Biological Technology Co., Ltd. [2023-03-13 15:04:09 ]
H GH fragment 176-191 Synonyms Fragment 17 6 -191, AOD-9604 MF C78H123N23O23S2 MW 1815.08152 CAS 221231-10-3 Appearance White Powder Purity 98% Grade Pharmaceutical Grade Storage Closed, below 2 ~ 8 C preservation Usage AOD9604 actually acts on the reduction of excessive adipose
Zhuhai Shuangbojie Pharmaceutical Technology Co.,Ltd [2016-03-25 17:07:04 ]
Pumpkin Kernels Wholesale Manda Food’s pepitas and pumpkin seeds from pumpkin are raw, shelled and edible. As a Chinese pumpkin seeds supplier, Manda has China pumpkin seeds wholesale to many countries at a competitive bulk prices. Features of Manda Pumpkin Seeds Kernel Pumpkin
Tianjin Manda Food Science and Technology Co.,Ltd [2022-09-23 09:34:31 ]
【 Product name 】 Zinc Sulphate Monohydrate 35%min powder form 【 Chemical formula 】 ZnSO4•H2O 【 CAS 】 7446-19-7 【 Molecular weight 】 179.47 【 Product performance 】 Zinc is the forming element of many enzymes and hormone, and participates in metabolism of
polifar group limited [2016-01-28 16:42:47 ]
【 Chemical formula 】 ZnSO4•H2O 【 CAS 】 7446-19-7 【 Molecular weight 】 179.47 【 Product performance 】 Zinc is the forming element of many enzymes and hormone,and participates in metabolism of protein, carbohydrate as well as lipid. When lack of zinc, animals
polifar group limited [2016-01-28 15:53:06 ]
Walnut oil content is as high as 65% to 70%, ranking first among all woody oils, and has the reputation of “tree oil depot”. Using modern technology to extract its essence, this is the new generation of walnut products - walnut oil. Walnut oil is a natural fruit oil juice tha
Hebei QianGang Biotech CO., Ltd [2019-08-19 12:02:36 ]
Organic Clear Goji Juice Concentrate /Puree Goji Juice Goji Berry Juice Details Package and Storage Package 25kg/drum, inner packing with double aseptic bag ,outer with drum 200kg drum ,inner packing with double aseptic bag ,outer with drum net weight 200kg/drum(with inner asept
Ningxia Pure Biology Technology Co., Ltd [2018-06-26 19:20:37 ]
Formula C11H19N5S CAS 28159-98-0 EINECS 248-872-3 Synonyms 1,3,5-Triazine-2,4-diamine,N-cyclopropyl-N\'-(1,1-dimethylethyl)-6-(methylthio)- (9CI);Cybutrin;Cybutryne;Irgaguard A 2000;Irgarol 1051;Irgarol 1071;Microban Additive IA 1;N-Cyclopropyl-N\'-(1,1-dimethylethyl)-6-(methylth
无锡市耀得信化工产品有限公司 [2015-07-31 10:30:53 ]
