Muscle Gain&Anti Aging Peptide Ghrp-2 If you are looking for anti-aging properties or for the ability to increase lean body mass gains on cycle/off cycle, or even as a bridge, GHRP-2 will help you on that path. It is a very potent growth hormone releasing peptide. As always, plea
fewrfeggth [2018-06-29 09:01:31 ]
About us Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment, products testing service (free). We can also supply rhGH, HGH,HCG, Hygetropin, Jintropin, Taitropin, Igtropin,Kigtropin,IGF-I, IGF-1 LR-3, IGF-1,Blue top, Red top,
Hongkong Green Sci Biotech CO. Ltd [2015-09-28 12:25:36 ]
Hgh Fragment 176-191 Human Growth Hormone Keep Young Anti-age HGH Frag 176-191 Sequence For more details Plz contact lmy@ycphar com HGH fragments refer to modified forms of amino acids, in this case amino acid 176-191. Studies indicate that this chemical has potential use in impr
Tai'an City Jia biotechnology industry Co.Ltd [2016-10-11 17:52:42 ]
Thyroid Function The thyroid gland is a 2-inches long, butterfly-shaped endocrine gland generally located in the lower front of the neck. The thyroid functions to make thyroid hormones, which are released into the blood and then carried to every tissue in the body. Thyroid hormon
Shenzhen SEKBIO Co., Ltd [2023-03-14 14:16:12 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-G
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:58:01 ]
Product Name CJC-1295 Acetate Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Cas No. 863288-34-0 Molecular Formula C165H271N47O46 Molecular Weight 3649.30 Purity (HPLC) 98.
HB YUANCHENG SAICHUANG TECHNOLOGY CO., LTD [2016-08-31 11:20:17 ]
somatotropin (176-191) 66004-57-7 Somatotropin 12629-01-5 Product name hgh Somatotropin Synonyms growth hormone, human CAS 12629-01-5 EINECS 235-735-8 [ Density ] 1.4±0.1 g/cm3 [ Boiling Point ] 1580.5±75.0 °C at 760 mmHg [ Molecular Formula ] C990H1529N263O299S7 [ Molecular W
Shanghai Xinbei Technology Co., Ltd [2018-11-19 10:36:16 ]
Riptropin HGH Riptropin Hgh Supplier Riptropin 191-Aa Human Growth Hormone hghsalehumanstech(at)gmail dot com We can supply them with High Quality,Low Price and Safe Shipping. Please Send your email address into your inquiry,thank you! Commodity Name Riptropin Specification 100iu
Humans Technology Co.,Ltd [2014-02-24 09:52:34 ]
Kigtropin HGH Kigtropin Hgh Supplier Kigtropin 191-Aa Human Growth Hormone hghsalehumanstech(at)gmail dot com We can supply it with High Quality,Low Price and Safe Shipping. Please Send your email address into your inquiry,thank you! Commodity Name Kigtropin Specification 100iu/k
Humans Technology Co.,Ltd [2013-10-09 16:59:12 ]
Product Name Gonadorelin Acetate Sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 Cas No. 71447-49-9 Molecular Formula C55H75N17O13 Molecular Weight 1182.3 Purity (HPLC) 98.0%min. Appearance? White powder Single Impurity(HPLC)? 0.5%max Amino Acid Composition? ±10% of theoret
Wuhan Yuancheng Phamacy Co., Ltd [2016-09-24 11:27:03 ]
hghsalehumanstech(at)gmail dot com Hygetropin HGH 100iu Hygetropin Hgh Supplier Hygetropin 191-Aa Human Growth Hormone We can supply them with High Quality,Low Price and Safe Shipping. Please Send your email address into your inquiry,thank you! Commodity Name Hygetropin Specifica
Humans Technology Co.,Ltd [2014-04-15 09:38:43 ]
Hygetropin HGH 200iu Hygetropin Hgh Supplier Hygetropin 191-Aa Human Growth Hormone hghsalehumanstech(at)gmail dot com We can supply them with High Quality,Low Price and Safe Shipping. Please Send your email address into your inquiry,thank you! Commodity Name Hygetropin Specifica
Humans Technology Co.,Ltd [2014-04-15 09:36:08 ]
Product Name Gonadorelin Acetate Sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 Cas No. 71447-49-9 Molecular Formula C55H75N17O13 Molecular Weight 1182.3 Purity (HPLC) 98.0%min. Appearance? White powder Single Impurity(HPLC)? 0.5%max Amino Acid Composition? ±10% of theoret
HB YUANCHENG SAICHUANG TECHNOLOGY CO., LTD [2016-08-31 10:52:04 ]
Product Name Gonadorelin Acetate Sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 Cas No. 71447-49-9 Molecular Formula C55H75N17O13 Molecular Weight 1182.3 Purity (HPLC) 98.0%min. Appearance? White powder Single Impurity(HPLC)? 0.5%max Amino Acid Composition? ±10% of theoret
HB YUANCHENG SAICHUANG TECHNOLOGY CO., LTD [2016-08-31 09:31:29 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com CJC-1295 DAC (Drug Affinity Complex) Alias CJC1295(GHRH/DAC) Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Ly
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:27:44 ]
CJC-1295 without DAC Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Cas No. 863288-34-0 Molecular Formula C165H271N47O46 Molecular Weight 3649.30 Purity (HPLC) 98.0% Single
Wuhan Yuancheng Phamacy Co., Ltd [2016-09-07 16:27:33 ]
CJC-1295 without DAC Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Cas No. 863288-34-0 Molecular Formula C165H271N47O46 Molecular Weight 3649.30 Purity (HPLC) 98.0% Single
HB YUANCHENG SAICHUANG TECHNOLOGY CO., LTD [2016-08-31 10:44:09 ]
Blue tops hgh Blue tops hgh Supplier Blue tops hgh 191-Aa Human Growth Hormone hghsalehumanstech(at)gmail dot com We can supply them with High Quality,Low Price and Safe Shipping. Please Send your email address into your inquiry,thank you! Commodity Name Blue tops Specification 1
Humans Technology Co.,Ltd [2014-02-24 09:57:57 ]
coco@pharmade com http://www bestroidlabs com Name 1,4-Butanediol CAS 110-63-4 Chemical Names 1,4-BUTANEDIOL; Butane-1,4-diol; 110-63-4; 1,4-Butylene glycol Molecular Formula C4H10O2 Molecular Weight 90.122 g/mol Melting point 20°C Boiling point 230°C Flash point 135°C How doe
shenzhen shijingu [2019-01-09 16:44:20 ]
Product Name CJC-1295 Acetate Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Cas No. 863288-34-0 Molecular Formula C165H271N47O46 Molecular Weight 3649.30 Purity (HPLC) 98.
Wuhan Yuancheng Phamacy Co., Ltd [2016-09-24 10:21:53 ]