We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Synonyms/Alias GS peptide-2 CAS No. 851366-97-7 Sequence YRRAAVPPSPSLSRHSSPHQSEDEEE (Modifications Ser-21 = OPO3H
Creative Peptides [2017-10-16 14:13:43 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We provi
Creative Peptides [2017-10-16 14:12:46 ]
CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on
Creative Peptides [2017-10-16 14:12:09 ]
Product Name Filing cabinet Brand Feng Long Model FC-N3-3 Dimension H1031mm*W452mm*D620mm, per customer`s requirement Packing Volume 0.069CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office furniture Port Qingdao,S
LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD [2017-10-16 14:11:15 ]
Sequence KRMKVAKSAQ M W/Mr. 1146.42 Molecular Formula C48H91N17O13S Storage -20°C Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturin
Creative Peptides [2017-10-16 14:10:18 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. More information please visit our website https://www creative-peptides com/product/lep-mouse-item-r0836-34638.html CAT#R0836 CAS No.258276-95-8 SequenceSCSLPQTSGLQKPES (Modif
Creative Peptides [2017-10-16 14:09:27 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We provi
Creative Peptides [2017-10-16 14:08:21 ]
Item Specifications Product Name Steel cabinet Brand Feng Long Model SC-L1 Dimension H900mm*W400mm*D900mm, per customer`s requirement Packing Volume 0.093CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office furnitur
LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD [2017-10-16 14:07:55 ]
Sequence SSGMPLGATGL M W/Mr. 990.14 Molecular Formula C41H71N11O15S Storage -20°C Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturin
Creative Peptides [2017-10-16 14:07:11 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAT# R0832 CAS No. 5991-13-9 Sequence RFPSFGPPR M W/Mr. 1060.22 Molecular Formula C50H73N15O11 Storage -20°C We
Creative Peptides [2017-10-16 14:04:11 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAT#R083
Creative Peptides [2017-10-16 14:03:19 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAS No.5
Creative Peptides [2017-10-16 14:02:26 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAT#R082
Creative Peptides [2017-10-16 14:01:32 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ht
Creative Peptides [2017-10-16 14:00:22 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ht
Creative Peptides [2017-10-16 13:59:23 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ht
Creative Peptides [2017-10-16 13:56:36 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ht
Creative Peptides [2017-10-16 13:55:43 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ht
Creative Peptides [2017-10-16 13:54:43 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ht
Creative Peptides [2017-10-16 13:52:54 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ht
Creative Peptides [2017-10-16 13:52:17 ]