Product name hex coupling nut Size M3-M20, 1/4-1 Finish plain/zinc plated/yellow plated Grade 4.8/6.8/8.8, 2/5/8 Material carbon steel Packing bulk or depend on customer\'s request Certification ISO9001 Hex coupling nut is our main production, we have rich experience and competit
Haiyan Taiji Fasteners Co., Ltd [2016-12-20 10:56:04 ]
Product name hex nut Size M3-M20, 1/4-1 Finish zp/plain Grade 4.8/6.8/8.8, 2/5/8 Material carbon steel Packing bulk or depend on customer\'s request Certification ISO9001 Hex nut is our main production, we have rich experience and competitive price. The specific produce is depend
Haiyan Taiji Fasteners Co., Ltd [2016-12-20 10:44:12 ]
Product name flange nut Size M3-M20, 1/4-1 Finish zp/plain Grade 4.8/6.8/8.8, 2/5/8 Material carbon steel Packing bulk or depend on customer\'s request Certification ISO9001 Din6923 flange nut is our main production, we have rich experience and competitive price. The specific pro
Haiyan Taiji Fasteners Co., Ltd [2016-12-20 10:40:31 ]
Product name steel fire door hollow metal door fire rated door fire proof door Standard US standard Size Customized Certificate FM, WH 45mins, 90mins, 180mins Thickness 1-3/4” (45mm) Material 0.9mm, 1.1mm CRS, galv. Galvanneal steel Core HC, PS, mineral fire board Frame 1.4mm C
Dalian Golden House Door & Window Manufacturer Co.,Ltd. [2016-12-19 15:29:42 ]
Custom designed yoga mat good for hot yoga Product name custom designed microfiber suede Yoga Mat good for hot yoga Material Natural rubber Color Any color customize Printing Technic Printed, Woven lable/tag Customized designs are welcome. Logo OEM Sample Time 5-7 days Mass Produ
Hangzhou Fanmao Technology Co., Ltd. [2016-12-16 11:40:03 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Dextromethorphan Hydrobromide Key words Dextromethorphan Hydrobromide,Dextromethorphan Hydrobromide,Dextromethorphan Hydrobromide,Dextromethorphan Hydrobromide Dextromethorphan
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:51:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Deslorelin Synonyms GLP-HIS-TRP-SER-TYR-D-TRP-LEU-ARG-PRO-NHET;[D-TRP6, DES-GLY10]-LH-RH ETHYLAMIDE;DESORELIN;DESLORELIN;deslorelin acetate;DESLORELIN (HUMAN);DES-GLY10,[D-TRP6]
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:43:06 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Epitalon,10mg/vial Product Name Glycine, L-alanyl-L-a-glutamyl-L-a-aspartyl- Synonyms Epitalon;Epithalon;Glycine, L-alanyl-L-a-glutamyl-L-a-aspartyl-;L-alanyl-L-alpha-glutamyl-L-alpha-aspart
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:40:40 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-G
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:58:01 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Hexarelin Synonyms HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE RELEASING HEXAPEPTIDE;Examorelin;Hexareline;L-Histidyl-2-methyl
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:55:45 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Quick Detail Product Name GHRP-2 Growth Hormone Releasing Peptide 2 GHRP Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular formula C45H55N9O6 Molar Mass 817.9 CAS number 158861-67-7 P
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:36:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com MT-2 Product Name Melanotan II, MT- II split into vivals, MT2 supplier, Melanotan II manufacturer MT2 Another Name Melanotan II; AC-NLE-CYCLO(-BETA-ASP-HIS-D-PHE-ARG-TRP-EPSILON-LYS-NH2); Me
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:35:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name PT-141 Synonyms BREMELANOTIDE;Brmelanotice;Ac-Nle-cyclo(-Asp-His-D-Phe-Arg-Trp-Lys)-OH;Bremelanotide, PT141,PT-141;BREMELANOTIDE PT141;N-Acetyl-L-norleucyl-L-alpha-aspartyl-L-hi
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:30:16 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name 1,3-Dimethylpentylamine hydrochloride Key words 1,3-Dimethylpentylamine hydrochloride,1,3-Dimethylpentylamine hydrochloride,DMAA hcl,DMAA hcl,DMAA hcl Synonyms 4-Methyl-2-hexana
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:18:42 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Ethyl Oleate Product Name Ethyl Oleate Synonyms Ethyl Oleate;(Z)-9-Octadecenoic acid ethyl ester;ethylcis-9-octadecenoate CAS 111-62-6 MF C20H38O2 MW 310.51 EINECS 203-889-5 Apperance clear
Guangzhou Kafen Biotech Co.,Ltd [2016-12-09 16:05:38 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com 1.Quick Details Product Name 1,4-Butanediol (BDO) Appearance Colorless liquid CAS RN. 110-63-4 Purity 99.7% EINECS 203-786-5 Molecular Weight 90.121 Molecular Formula C4H10O2 Density 1.006g
Guangzhou Kafen Biotech Co.,Ltd [2016-12-09 16:02:32 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com OSTARINE/MK-2866 Product Name (S)-N-(4-cyano-3-(trifluoromethyl)phenyl)-3-(4-cyanophenoxy)-2-hydroxy-2-methylpropanamide Synonyms (S)-N-(4-cyano-3-(trifluoromethyl)phenyl)-3-(4-cyanophenoxy)
Guangzhou Kafen Biotech Co.,Ltd [2016-12-09 15:31:58 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com MK-677/IbutaMoren Mesylate Product Name MK-677 Synonyms MK-677;2-Amino-N-[(1R)-2-[1,2-dihydro-1-(methylsulfonyl)spiro[3H-indole-3,4\'-piperidin]-1\'-yl]-2-oxo-1-[(phenylmethoxy)methyl]ethyl]
Guangzhou Kafen Biotech Co.,Ltd [2016-12-09 15:30:01 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Liothyronine sodium T3 Na Powder Product Name Liothyronine sodium Key words Liothyronine Sodium,Liothyronine Sodium,Liothyronine Sodium,T3 Na,T3 Na,T3 Na Alias Cytomel T3 ; 3,3\',5－triiodo
Guangzhou Kafen Biotech Co.,Ltd [2016-12-09 15:14:05 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Trestolone Acetate Key words Trestolone Acetate, Trestolone Acetate, Trestolone Acetate, Trestolone Acetate powder, Trestolone Acetate Material Alias 17 beta-hydroxy-7 alpha-met
Guangzhou Kafen Biotech Co.,Ltd [2016-12-09 15:05:19 ]
