Searching name , total 974368 products,queries done in 70 ms
Testosterone propionate

Testosterone propionate Chemical Name 4-Androsten-17beta-ol-3-one propionate CAS NO. 57-85-2 Molecular Formula C22H32O3 Molecular weight 344.49 Standard USP28/BP2003 Testosterone propionate Chemical Name 4-Androsten-17beta-ol-3-one propionate CAS NO. 57-85-2 Molecular Formula C22

wuhan Yuancheng saichuang Co.,Ltd      [2016-12-19 13:45:15 ]

Testosterone Phenylpropionate

Testosterone Isocaproate Chemical Name 4-Androsten-17beta-ol-3-one Isocapronate CAS NO. 15262-86-9 Molecular Formula C25H38O3 Molecular weight 386.57 Assay 97.0% Appearance white crystalline powder Standard BP2003 Molecular Formula C25H38O3 Molecular weight 386.57 Assay 97.0% App

wuhan Yuancheng saichuang Co.,Ltd      [2016-12-19 13:43:44 ]

Testosterone Phenylpropionate

Testosterone Phenylpropionate Chemical Name 4-Androsten-17beta-ol-3-one Phenylpropionate CAS NO. 1255-49-8 Molecular Formula C28H36O3 Molecular weight 420.58 Appearance white crystalline powder; MP white crystalline powder Standard BP2003 Testosterone Phenylpropionate Chemical Na

wuhan Yuancheng saichuang Co.,Ltd      [2016-12-19 13:42:44 ]

Testosterone Isocaproate

Testosterone Isocaproate Chemical Name 4-Androsten-17beta-ol-3-one Isocapronate CAS NO. 15262-86-9 Molecular Formula C25H38O3 Molecular weight 386.57 Assay 97.0% Appearance white crystalline powder Standard BP2003 Testosterone Isocaproate Chemical Name 4-Androsten-17beta-ol-3-one

wuhan Yuancheng saichuang Co.,Ltd      [2016-12-19 13:41:34 ]

Ergo Ratchet Lashing Straps

ERGO TENSILE RATCHET LASHING STRAPS, PERMISSIBLE TENSILE FORCE LC 2500/5000 daN, PRETENSION STF 500 daN. 1) material 100% polyester 2) webbing width 50mm 3) safety factor 2 1 4) Capacity 5T 5) manufactured according to DIN EN12195-2 6) color according to your requirement 7) end f

Weifang Zhenhong Group Co.,ltd      [2016-12-19 10:42:17 ]

Testosterone Cypionate

Testosterone Acetate Other name testosterone acetate--dea schedule iii; (17beta)-3-oxoandrost-4-en-17-yl acetate; 3-oxoandrost-4-en-17-yl acetate CAS NO 1045-69-8 Appearance White crystalline powder. Package 1kg/Foil bag Testosterone Acetate Other name testosterone acetate--dea s

wuhan Yuancheng saichuang Co.,Ltd      [2016-12-18 17:57:19 ]

Testosterone Acetate

Testosterone Acetate Other name testosterone acetate--dea schedule iii; (17beta)-3-oxoandrost-4-en-17-yl acetate; 3-oxoandrost-4-en-17-yl acetate CAS NO 1045-69-8 Appearance White crystalline powder. Package 1kg/Foil bag Testosterone Acetate Other name testosterone acetate--dea s

wuhan Yuancheng saichuang Co.,Ltd      [2016-12-18 17:56:06 ]

Polyster/Cotton Gray Fabric Suppliers

Quick Information Brand Name xingye Place of Origin China Model Number 05 Description Polyster/Cotton Gray Fabric Suppliers Introduction of polyester cotton fabric Name Polyester cotton fabric Composition Yarn count Density Weight Width Pattern T/C 40/60 20*16 120*60 245 63\'\'

Shenze Cinye Textile Co.,Ltd.      [2016-12-16 17:25:35 ]

100% Cotton Fabric Whith Flower Printed

Quick Information Brand Name xingye Place of Origin China Model Number 010 Description 100%cotton Fabric Whith Flower Printed Material 100% Cotton Yarn Count 32s Density 133*75 Width 250cm Weight 390gsm Style Reactive dyes printed, twill. Name Printed fabric cotton fabric Compos

Shenze Cinye Textile Co.,Ltd.      [2016-12-16 17:21:37 ]

Professional custom printed microfiber yoga mats for hot yoga

Custom designed yoga mat good for hot yoga Product name custom designed microfiber suede Yoga Mat good for hot yoga Material Natural rubber Color Any color customize Printing Technic Printed, Woven lable/tag Customized designs are welcome. Logo OEM Sample Time 5-7 days Mass Produ

Hangzhou Fanmao Technology Co., Ltd.      [2016-12-16 11:40:03 ]

C/U Keel Roll Forming Machine

Quick Details Name C/Z Keel Roll Forming Machine Condition New Type Tile Forming Machine Tile type colored steel Brand name RFM Place of origin Hebei,China Usage Roofing accessories Dimension 3.5*1.2*1.45 Weight 2.5T Raw material PPGI/GI Material thickness 0.3-0.8mm Machine frame

Hebei Feixiang Roll Forming Machinery Co.,Ltd      [2016-12-14 15:31:58 ]

Dextromethorphan Hydrobromide Dextromethorphan Hydrobromide

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Dextromethorphan Hydrobromide Key words Dextromethorphan Hydrobromide,Dextromethorphan Hydrobromide,Dextromethorphan Hydrobromide,Dextromethorphan Hydrobromide Dextromethorphan

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:51:57 ]

Dexamethasone

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Dexamethasone Another Name 9-alpha-fluoro-11-beta,17-alpha,21-trihydroxy-16-alpha-methylpregna-1,4-diene-3,20-dione; 9-alpha-fluoro-16-alpha-methylprednisolone; 9alpha-Fluoro-11beta,17alpha,

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:48:30 ]

Nonapeptide-1

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com INCI Name Nonapeptide-1 Amino Sequence Met-Pro-D-Phe-Arg-D-Trp-Phe-Lys-Pro-Val-NH2 Functions · Prevent melanin synthesis by preventing activation of the tyrosinase. · Prevent unwanted pigm

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:45:12 ]

Deslorelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Deslorelin Synonyms GLP-HIS-TRP-SER-TYR-D-TRP-LEU-ARG-PRO-NHET;[D-TRP6, DES-GLY10]-LH-RH ETHYLAMIDE;DESORELIN;DESLORELIN;deslorelin acetate;DESLORELIN (HUMAN);DES-GLY10,[D-TRP6]

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:43:06 ]

Epitalon

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Epitalon,10mg/vial Product Name Glycine, L-alanyl-L-a-glutamyl-L-a-aspartyl- Synonyms Epitalon;Epithalon;Glycine, L-alanyl-L-a-glutamyl-L-a-aspartyl-;L-alanyl-L-alpha-glutamyl-L-alpha-aspart

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:40:40 ]

Sermorelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-G

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:58:01 ]

Hexarelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Hexarelin Synonyms HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE RELEASING HEXAPEPTIDE;Examorelin;Hexareline;L-Histidyl-2-methyl

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:55:45 ]

GHRP-2

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Quick Detail Product Name GHRP-2 Growth Hormone Releasing Peptide 2 GHRP Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular formula C45H55N9O6 Molar Mass 817.9 CAS number 158861-67-7 P

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:36:57 ]

Melanotan 2

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com MT-2 Product Name Melanotan II, MT- II split into vivals, MT2 supplier, Melanotan II manufacturer MT2 Another Name Melanotan II; AC-NLE-CYCLO(-BETA-ASP-HIS-D-PHE-ARG-TRP-EPSILON-LYS-NH2); Me

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:35:57 ]