name - Manufacturers, Suppliers & Exporters
Quick Details Place of Origin Guangdong, China (Mainland) Brand Name RK Aluminum Stage Model Number RKAS-08 material aluminum color red, grey, red surface carpet, non-slip, rubber height 0.4-2.2M loading capacity 750KG/S Q. Packaging & Delivery Packaging Details cartoon boxes Del
rack in the cases [2016-12-19 16:57:57 ]
Quick Details Place of Origin Guangdong, China (Mainland) Brand Name RK Aluminum Stage Model Number RKAS-01 material aluminum color red, grey, red surface carpet, non-slip, rubber height 0.4-2.2M loading capacity 750KG/S Q. Packaging & Delivery Packaging Details cartoon boxes Del
rack in the cases [2016-12-19 16:42:00 ]
Brand Name Golden House Model Numbe ： GH-W98 Open Style Swing Position Commercial Surface Finishing Finished Type wooden fire door Door Material MDF Color wood color Material MDF, mineral fireboard, Name wooden fire door Size Cutomized Surface VENEER FINISH Certificate UL, WH i
Dalian Golden House Door & Window Manufacturer Co.,Ltd. [2016-12-19 15:44:19 ]
Product name steel fire door hollow metal door fire rated door fire proof door Standard US standard Size Customized Certificate FM, WH 45mins, 90mins, 180mins Thickness 1-3/4” (45mm) Material 0.9mm, 1.1mm CRS, galv. Galvanneal steel Core HC, PS, mineral fire board Frame 1.4mm C
Dalian Golden House Door & Window Manufacturer Co.,Ltd. [2016-12-19 15:29:42 ]
ERGO TENSILE RATCHET LASHING STRAPS, PERMISSIBLE TENSILE FORCE LC 2500/5000 daN, PRETENSION STF 500 daN. 1) material 100% polyester 2) webbing width 50mm 3) safety factor 2 1 4) Capacity 5T 5) manufactured according to DIN EN12195-2 6) color according to your requirement 7) end f
Weifang Zhenhong Group Co.,ltd [2016-12-19 10:42:17 ]
Quick Information Brand Name xingye Place of Origin China Model Number 05 Description Polyster/Cotton Gray Fabric Suppliers Introduction of polyester cotton fabric Name Polyester cotton fabric Composition Yarn count Density Weight Width Pattern T/C 40/60 20*16 120*60 245 63\'\'
Shenze Cinye Textile Co.,Ltd. [2016-12-16 17:25:35 ]
Quick Information Brand Name xingye Place of Origin China Model Number 010 Description 100%cotton Fabric Whith Flower Printed Material 100% Cotton Yarn Count 32s Density 133*75 Width 250cm Weight 390gsm Style Reactive dyes printed, twill. Name Printed fabric cotton fabric Compos
Shenze Cinye Textile Co.,Ltd. [2016-12-16 17:21:37 ]
Custom designed yoga mat good for hot yoga Product name custom designed microfiber suede Yoga Mat good for hot yoga Material Natural rubber Color Any color customize Printing Technic Printed, Woven lable/tag Customized designs are welcome. Logo OEM Sample Time 5-7 days Mass Produ
Hangzhou Fanmao Technology Co., Ltd. [2016-12-16 11:40:03 ]
Quick Details Name C/Z Keel Roll Forming Machine Condition New Type Tile Forming Machine Tile type colored steel Brand name RFM Place of origin Hebei,China Usage Roofing accessories Dimension 3.5*1.2*1.45 Weight 2.5T Raw material PPGI/GI Material thickness 0.3-0.8mm Machine frame
Hebei Feixiang Roll Forming Machinery Co.,Ltd [2016-12-14 15:31:58 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Dextromethorphan Hydrobromide Key words Dextromethorphan Hydrobromide,Dextromethorphan Hydrobromide,Dextromethorphan Hydrobromide,Dextromethorphan Hydrobromide Dextromethorphan
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:51:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Dexamethasone Another Name 9-alpha-fluoro-11-beta,17-alpha,21-trihydroxy-16-alpha-methylpregna-1,4-diene-3,20-dione; 9-alpha-fluoro-16-alpha-methylprednisolone; 9alpha-Fluoro-11beta,17alpha,
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:48:30 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com INCI Name Nonapeptide-1 Amino Sequence Met-Pro-D-Phe-Arg-D-Trp-Phe-Lys-Pro-Val-NH2 Functions · Prevent melanin synthesis by preventing activation of the tyrosinase. · Prevent unwanted pigm
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:45:12 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Deslorelin Synonyms GLP-HIS-TRP-SER-TYR-D-TRP-LEU-ARG-PRO-NHET;[D-TRP6, DES-GLY10]-LH-RH ETHYLAMIDE;DESORELIN;DESLORELIN;deslorelin acetate;DESLORELIN (HUMAN);DES-GLY10,[D-TRP6]
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:43:06 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Epitalon,10mg/vial Product Name Glycine, L-alanyl-L-a-glutamyl-L-a-aspartyl- Synonyms Epitalon;Epithalon;Glycine, L-alanyl-L-a-glutamyl-L-a-aspartyl-;L-alanyl-L-alpha-glutamyl-L-alpha-aspart
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:40:40 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-G
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:58:01 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Hexarelin Synonyms HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE RELEASING HEXAPEPTIDE;Examorelin;Hexareline;L-Histidyl-2-methyl
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:55:45 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Quick Detail Product Name GHRP-2 Growth Hormone Releasing Peptide 2 GHRP Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular formula C45H55N9O6 Molar Mass 817.9 CAS number 158861-67-7 P
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:36:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com MT-2 Product Name Melanotan II, MT- II split into vivals, MT2 supplier, Melanotan II manufacturer MT2 Another Name Melanotan II; AC-NLE-CYCLO(-BETA-ASP-HIS-D-PHE-ARG-TRP-EPSILON-LYS-NH2); Me
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:35:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name PT-141 Synonyms BREMELANOTIDE;Brmelanotice;Ac-Nle-cyclo(-Asp-His-D-Phe-Arg-Trp-Lys)-OH;Bremelanotide, PT141,PT-141;BREMELANOTIDE PT141;N-Acetyl-L-norleucyl-L-alpha-aspartyl-L-hi
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:30:16 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name 1,3-Dimethylpentylamine hydrochloride Key words 1,3-Dimethylpentylamine hydrochloride,1,3-Dimethylpentylamine hydrochloride,DMAA hcl,DMAA hcl,DMAA hcl Synonyms 4-Methyl-2-hexana
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:18:42 ]
