Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Epitalon,10mg/vial Product Name Glycine, L-alanyl-L-a-glutamyl-L-a-aspartyl- Synonyms Epitalon;Epithalon;Glycine, L-alanyl-L-a-glutamyl-L-a-aspartyl-;L-alanyl-L-alpha-glutamyl-L-alpha-aspart
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:40:40 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-G
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:58:01 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Hexarelin Synonyms HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE RELEASING HEXAPEPTIDE;Examorelin;Hexareline;L-Histidyl-2-methyl
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:55:45 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Quick Detail Product Name GHRP-2 Growth Hormone Releasing Peptide 2 GHRP Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular formula C45H55N9O6 Molar Mass 817.9 CAS number 158861-67-7 P
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:36:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com MT-2 Product Name Melanotan II, MT- II split into vivals, MT2 supplier, Melanotan II manufacturer MT2 Another Name Melanotan II; AC-NLE-CYCLO(-BETA-ASP-HIS-D-PHE-ARG-TRP-EPSILON-LYS-NH2); Me
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:35:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name PT-141 Synonyms BREMELANOTIDE;Brmelanotice;Ac-Nle-cyclo(-Asp-His-D-Phe-Arg-Trp-Lys)-OH;Bremelanotide, PT141,PT-141;BREMELANOTIDE PT141;N-Acetyl-L-norleucyl-L-alpha-aspartyl-L-hi
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:30:16 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name 1,3-Dimethylpentylamine hydrochloride Key words 1,3-Dimethylpentylamine hydrochloride,1,3-Dimethylpentylamine hydrochloride,DMAA hcl,DMAA hcl,DMAA hcl Synonyms 4-Methyl-2-hexana
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:18:42 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Phenacetin Another Name 1-acetamido-4-ethoxybenzene; para-Acetophenetidide; p-acetophenetidine; p-acetophenetide; p-acetphenetidin; paracetophentidin; p-Ethoxyacetanilide; 4\'-ethoxyacetanil
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 13:34:42 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Benzocaine Another Name 4-Aminobenzoic acid ethyl ester; benzocaine methanol solution; Ethyl 4-aminobenzoate,(4-Aminobenzoic acid ethyl ester); Benzocaine; H-4-Abz-OEt; Benzocione; 4-(ethoxy
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 10:12:27 ]
Type Garden Hose Reels Place of Origin Shandong, China (Mainland) Brand Name Tianyi Model Number TianYi-2810N-1 Garden Hose Reel Type Empty Hose Reels Material Metal / Coil Standard CE Diameter 3/8\'\' Feature Adjustable, Anti-Abrasion, Anti-Corrosion, Anti-UV, Soft Use Burnishin
Shandong Tainyi Equipment&Technology Co.,Ltd [2016-12-10 14:35:06 ]
Type Garden Hose Reels Place of Origin Shandong, China (Mainland) Brand Name Tianyi Model Number TY-2810S-1 Garden Hose Reel Type Empty Hose Reels Material Metal Metal Type Stainless Steel Standard CE Diameter 3/8\'\' Feature Adjustable, Anti-Abrasion, Anti-Corrosion, Anti-UV, Re
Shandong Tainyi Equipment&Technology Co.,Ltd [2016-12-10 14:27:50 ]
Type Garden Hose Reels Place of Origin Shandong, China (Mainland) Brand Name Tianyi Model Number TY-4810N-1 Garden Hose Reel Type Empty Hose Reels Material Plastic Plastic Type PU Standard ANSI Diameter 3/8\'\' Feature Adjustable, Anti-Abrasion, Anti-Corrosion, Anti-UV, Flexible,
Shandong Tainyi Equipment&Technology Co.,Ltd [2016-12-10 14:25:16 ]
Type Garden Hose Reels Place of Origin Shandong, China (Mainland) Brand Name Tianyi Model Number TY-2810S-1 Garden Hose Reel Type Empty Hose Reels Material rubber/metal/coil Standard ANSI Diameter 3/8\'\' Feature Adjustable, Anti-Abrasion, Anti-Corrosion, Anti-UV, Flexible, Rewin
Shandong Tainyi Equipment&Technology Co.,Ltd [2016-12-10 14:18:13 ]
Dehydronandrolon acetate Email angel(at)health-gym(dot)com Skype live angel_11616 Other name Dehydronandrolon; Dehydronandrolone-6 Acetate; 6-Dehydronandrolone acetate CAS 2590-41-2 Molecular formula C20H26O3 Molecular weight 314.42 Assay 98% Storage Controlled Substance, -20ºCF
HK Globle Sino Ocean Dev. Co., Limited [2016-12-10 09:25:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Benzyl Benzoate Another Name Benzyl benzoate 99+ %; Benzoic acid benzyl ester; Ascabin; Ascabiol; Benylate; Benzyl alcohol benzoic ester; BENZOATO DE BENCILO; Benzoic acid phenylmethyl ester
Guangzhou Kafen Biotech Co.,Ltd [2016-12-09 16:07:48 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Ethyl Oleate Product Name Ethyl Oleate Synonyms Ethyl Oleate;(Z)-9-Octadecenoic acid ethyl ester;ethylcis-9-octadecenoate CAS 111-62-6 MF C20H38O2 MW 310.51 EINECS 203-889-5 Apperance clear
Guangzhou Kafen Biotech Co.,Ltd [2016-12-09 16:05:26 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Guaiacol English Name Guaiacol English synonyms PYROGUAIAC ACID; O-METHOXYPHENOL; O-METHYLCATECHOL; CATECHOL MONOMETHYL ETHER; Gulaiacol Chinese synonyms guaiacol; guaiacol; 1,2- methoxy met
Guangzhou Kafen Biotech Co.,Ltd [2016-12-09 16:04:04 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com 1.Quick Details Product Name 1,4-Butanediol (BDO) Appearance Colorless liquid CAS RN. 110-63-4 Purity 99.7% EINECS 203-786-5 Molecular Weight 90.121 Molecular Formula C4H10O2 Density 1.006g
Guangzhou Kafen Biotech Co.,Ltd [2016-12-09 16:02:32 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com OSTARINE/MK-2866 Product Name (S)-N-(4-cyano-3-(trifluoromethyl)phenyl)-3-(4-cyanophenoxy)-2-hydroxy-2-methylpropanamide Synonyms (S)-N-(4-cyano-3-(trifluoromethyl)phenyl)-3-(4-cyanophenoxy)
Guangzhou Kafen Biotech Co.,Ltd [2016-12-09 15:31:58 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com MK-677/IbutaMoren Mesylate Product Name MK-677 Synonyms MK-677;2-Amino-N-[(1R)-2-[1,2-dihydro-1-(methylsulfonyl)spiro[3H-indole-3,4\'-piperidin]-1\'-yl]-2-oxo-1-[(phenylmethoxy)methyl]ethyl]
Guangzhou Kafen Biotech Co.,Ltd [2016-12-09 15:30:01 ]