h - Manufacturers, Suppliers & Exporters

Total 92309 products found

Solar Powered Firefly Mason Jar KF130063 Asst.

Solar Mason Jar, with Metal Silver Hanger and Brown Lid. 25 Warm white SMD LED. Jar Size Dia 10.0CM * H 16.5CM. Assorted Colors 3 Clear + 1 Red + 1 Green + 1 Blue, total 6pcs packed into one egg crate Master Carton.

HUIZHOU ZHONGXIN LIGHTING CO.,LTD [2016-12-12 18:58:26 ]

Tesamorelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Egrifta(tesamorelin) Sequence H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH Cas No. 106612-94-6 Purity (HPL

Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:09:58 ]

Sermorelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-G

Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:58:01 ]

GHRP-6

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com GHRP-6 (Growth hormone releasing peptide) Alias GROWTH HORMONE RELEASING PEPTIDE-6; [HIS1, LYS6]-GHRP; HIS-D-TRP-ALA-TRP-D-PHE-LYS-NH2; H-HIS-D-TRP-ALA-TRP-D-PHE-LYS-NH2 CAS 87616-84-0 Purit

Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:37:48 ]

GHRP-2

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Quick Detail Product Name GHRP-2 Growth Hormone Releasing Peptide 2 GHRP Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular formula C45H55N9O6 Molar Mass 817.9 CAS number 158861-67-7 P

Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:36:57 ]

14t trolley electric locomotive for large mine

14t trolley electric locomotive for large mine Mode CJY14/6,7,9G Trolley locomotive Technical Performance Adhesive weight 14T Voltage of battery 550V Horsepower 52*2kw Hourly Traction 26.68KN Max Traction 34.3KN Speed (hourly) 12.87 km/h Wheelbase 1700mm Track gauge 600,762,900m

HUNAN SOUTH ELECTRIC LOCOMOTIVE CO.,LTD [2016-12-12 13:00:33 ]

Benzocaine

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Benzocaine Another Name 4-Aminobenzoic acid ethyl ester; benzocaine methanol solution; Ethyl 4-aminobenzoate,(4-Aminobenzoic acid ethyl ester); Benzocaine; H-4-Abz-OEt; Benzocione; 4-(ethoxy

Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 10:12:27 ]

STS5900 RTV2 Neutral Two Parts Silicone Structural Sealant

STS5900 Two Parts Silicone Structural Sealant DESCRIPTION STS5900 Two Parts Silicone Structural Sealant is a two component, neutral curing silicone sealant with high modulus and high strength, purposely designed for structural glazing for structurally glazed curtain wall applicat

Jiangxi Starsealant Sealing Material Co., Ltd. [2016-12-10 15:30:41 ]

Andarine

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com ProName Andarine(S4) CasNo 401900-40-1 MF C 19 H 18 F 3 N 3 O 6 Appearance white powder Application Pharmaceutical intermediates DeliveryTime In stock PackAge Package as customer\'s require

Guangzhou Kafen Biotech Co.,Ltd [2016-12-09 15:44:51 ]

3BSE008550R1

Miya(manager) Email sales@mooreplc com Skype miyazheng520 QQ 2851195450 Tel 86-18020776792 (what\'sapp ) RS20-0400M2M2SDAPHC02.0.03 new and original GE FANUC IC693CBK004A CABLE KITGE FANUC IC693CBK004A CABLE KIT WHAT IS DETAILS ABOUT PLC We have a large stock and high-quality, p

ZHONGXINHANG AUTOMATION LIMITED Xiamen Office [2016-12-09 14:16:08 ]