Testosterone Isocaproate(testostero) English Synonyms 17beta-hydroxyandrost-4-ene-3-one 4-methylvalerate CAS NO. 15262-86-9 EINECS 239-307-1 Molecular Formula C25H38O3 Molecular Weight 386.57 Appearance White to white crystalline powder Standard BP Assay 97~103% Usage Adrenal cor
Zhuhai Shuangbojie Technology Co.,Ltd [2015-10-30 16:12:58 ]
Testosterone Decanoate CAS NO. 5721-91-5 Chemical Name 4-Androsten-17beta-ol-3-one Decanoate Chemical Formula C29H46O3 Description white or yellow white crystalline powder Product name Testosterone decanoate Synonym testosterone caproate CAS No. 5721-91-5 M F. C29H46O3 M W. 442.6
Zhuhai Shuangbojie Technology Co.,Ltd [2015-10-30 16:11:45 ]
Testosterone Cypionate(Supertest) Other name 17-(Cyclopentyl-1-oxopropoxy)androst-4-en-3-one;17b-(3-cyclopentylpropanoyloxy)androst-4-en-3-one;17b-Hydroxy-4-androsten-3-one,Cyclopentanepropionate CAS NO. 58-20-8 EINECS 200-368-4 Assay 98% min. Molecular Formula C27H40O3 Molecular
Zhuhai Shuangbojie Technology Co.,Ltd [2015-10-30 16:10:09 ]
Testosterone acetate Other name testosterone acetate--dea schedule iii; (17beta)-3-oxoandrost-4-en-17-yl acetate; 3-oxoandrost-4-en-17-yl acetate CAS 1045-69-8 MF C21H30O3 MW 330.46 EINECS 213-876-6 Appearance White crystalline powder. Chemical Properties White Solid Usage An And
Zhuhai Shuangbojie Technology Co.,Ltd [2015-10-30 16:07:53 ]
Testosterone base Synonyms testred;testex;oreton CAS 58-22-0 MF C19H28O2 MW 288.42 EINECS 200-370-5 Molecular formula C19H28O2 Appearance white or off-white crystalline powder Assay 98% min. Usage For disease-free testosterone replacement therapy, male menopause, impotence and ot
Zhuhai Shuangbojie Technology Co.,Ltd [2015-10-30 16:05:58 ]
Saful TS-YP708RED 7" Video Door Phone With Recording Function
Shenzhen Top Saful Electronic Tech CO.,LTD [2015-10-30 15:46:01 ]
Andarine/S4/Ostarine/MK-2866 Product Name S-3-(4-acetylamino-phenoxy)-2-hydroxy-2-methyl-N-(4-nitro-3-trifluoromethyl-phenyl)-propionamide Synonyms S-3-(4-acetylamino-phenoxy)-2-hydroxy-2-methyl-N-(4-nitro-3-trifluoromethyl-phenyl)-propionamide;N-[4-Nitro-3-(trifluoromethyl)pheny
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:59:48 ]
Stanozolol, Winstrol 99% Anabolic Stanozolol (CAS 10418-03-8) 99% Purity Stanozolol Coarse Winstrol Raw Powder Steroid Product Name Stanozolol Synonyms STANOZOL;STANOZOLOL;STANAZOL;winstrol l;1,10a,12a-Trimethyl-1,2,3,3a,3b,4,5,5a,6,8,10,10a,10b,11,12,12a-hexadecahydrocyclopenta[
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:52:00 ]
Stanolone Synonyms (5-alpha,17-beta)-17-hydroxyandrostan-3-one;(5alpha,17beta)-17-Hydroxy-androstan-3-one;17beta-Hydroxy-3-androstanone;17-beta-hydroxy-5-alpha-androstan-3-on;17-hydroxy-,(5-alpha,17-beta)-androstan-3-on;17-Hydroxyandrostan-3-one;5A-Androstan-3-on-17B-ol;5a-Andros
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:40:37 ]
Testosterone Blend, Testosterone Sustanon 250 Steroid Powder for Primary Muscle Building Testosterone Sustanon Bodybuilding Raw Testosterone Sustanon 250 Steroids Legit China Raw Testosterone Sustanon 250 for Bodybuilding Other Name Testosterone Sustanon 250 Component Test Propio
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:39:55 ]
Yortay Cosmetic Grade Chameleon Pigments Yortay cosmetic grade chameleon pigment is a high-tech synthetic inorganic pigment compounded by multiple inorganic oxide materials. Yortay cosmetic grade chameleon pigment shows changing colors & strong color shifting effect if you look f
Guangzhou Yortay Fine Chemicals Co.,Ltd. [2015-10-30 14:30:24 ]
Selank, 5mg/vial Alias Selanc CAS 129954-34-3 Sequence Thr-Lys-PRO-Arg-PRO-Gly-PRO MF C33H57N11O9 MW 751.9 Purity 99% Specification 5mg/vial Appearance White Lyophilized Powder Place of Origin China Standard USP Certification SGS Method of Analysis HPLC Storage Lyophilized peptid
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:29:48 ]
When used in color wallpapers, mica can increase reflectivity and heat resistance, reduce damage from UV radiation, light, and heat, boost resistance to acids and alkalis, increase electrical insulation, and provide a bright and attractive paint layer. It can also enhance their a
Guangzhou Yortay Fine Chemicals Co.,Ltd. [2015-10-30 14:28:24 ]
Sermorelin, 2mg/vial Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-AR
Zhuhaishi Shuangbojie Technology Co., Ltd [2015-10-30 14:23:18 ]
When used in color wallpapers, mica can increase reflectivity and heat resistance, reduce damage from UV radiation, light, and heat, boost resistance to acids and alkalis, increase electrical insulation, and provide a bright and attractive paint layer. It can also enhance their a
Guangzhou Yortay Fine Chemicals Co.,Ltd. [2015-10-30 14:22:57 ]
Drawstring Shape Velvet Ring Boxes,drawstring bag shaped velvet ring box,velvet ring jewelry box,flocking ring box
Seismo International Limited [2015-10-30 14:08:39 ]
Straight Side Glass Jars,bamboo lid glass jars,tall glass jars
Seismo International Limited [2015-10-30 12:55:08 ]
Custom Make Silk Shawl Manufacturer, Custom Silk Shawl
Hangzhou Hua Cui Yuan Silk Co., Ltd. [2015-10-30 12:47:04 ]
Test Enanthate Testosterone Steroid Powder Testosterone Enanthate skype holybiological_2 Email holybiological@holybiological com Owing to our years of experience, we hold expertise in manufacturing, supplying and exporting Testosterone Enanthate Raw Material Powder. The powder of
Hubei Holy Biological Co. Ltd [2015-10-30 11:33:53 ]
Sell A240 Grade 202, 301, 301L, 302 stainless plate Unitedsteel factory is specialized to produce stainless steel plates and our mill min thickness is 8mm for heavy stainless steel plate, Stainless Plate manufacturer, factory and mill. 1. ASTM A240 standard specification for chro
China United Iron and Steel Limited [2015-10-30 11:32:09 ]
