alpha:r* - Manufacturers, Suppliers & Exporters
Portable rf face skin care beauty machine/RF395 RF working principal This Radiofrequency (RF) utilizes 0.3MHz/s electric wave, which can permeate the epidermis to take effect on the underlying tissue. Highfrequency shake will make resistance of the underlying tissue move and prod
iTech Aesthetics Limited [2017-10-17 13:36:16 ]
Portable skin care monopolar rf beauty machine radio frequency treatment facial machine / RF395E Working principal This Radiofrequency (RF) utilizes 0.3MHz/s electric wave, which can permeate the epidermis to take effect on the underlying tissue. Highfrequency shake will make res
iTech Aesthetics Limited [2017-10-17 13:34:13 ]
Fote Heavy Machinery Co,.ltd can supply two types of dryer rotary drying machine and hot airflow type machine/equipment Rotary type drying equipment shows the features of perfect drying effect, easy operation, high efficiency and easy control of drying The rotary drying machine/e
Henan Fote Machinery Co., Ltd. [2017-10-17 11:32:26 ]
Spherical Roller Bearing Part No. 24048BC3W33, Inner Ring 240.000mm, Outer Ring 360.000mm, Width 118.000mm, Chamfer 3, Basic Dynamic Load Rating 1499KN, Basic Static Load Rating 2970KN, Limited Speed (rpm) 864(grease)/1120(oil), Gross Weight 46.8kg, Brass Cage Equipped with an ou
Cojinete Bearings Co., Ltd [2017-10-17 10:09:31 ]
Single Row Tapered Roller Bearing 32940, Inner Ring 200.000mm, Outer Ring 280.000mm, Width 51.000mm, Width of Inner Ring 51.000mm, Width of Outer Ring 39.000mm, Chamfer of Inner Ring 3mm, Chamfer of Outer Ring 2.5mm, Basic Dynamic Load Rating 460KN, Basic Static Load Rating 950KN
Cojinete Bearings Co., Ltd [2017-10-16 19:09:57 ]
Professional in BMC/SMC thermoset material production, with 15 years of BMC/SMC material production experience. High production capacity, stable product injection molding. BMC materials, products with bright appearance,good hand feeling, big-density materials, high in dimensional
MA.J Plastics Co.,LTD [2017-10-16 17:12:06 ]
Needle valve hot runner system, each hot nozzle can be independently controlled, time accuracy 0.01 seconds, to ensure that the weight of parts consistent. MA J’s history can be traced back to 1994, when our founders commenced to engage in the mold fabrication in China. Through
MA.J Plastics Co.,LTD [2017-10-16 17:05:40 ]
Professional in BMC/SMC thermoset material production, with 15 years of BMC/SMC material production experience. High production capacity, stable product injection molding. Producing terminals, plastic case, replacing assembly terminals, plastic case using PA material. With resist
MA.J Plastics Co.,LTD [2017-10-16 16:58:23 ]
Professional in BMC/SMC thermoset material production, with 15 years of BMC/SMC material production experience. High production capacity, stable product injection molding. Relay, contactor parts and components, contact support, heat resistance, surface hardness, mechanical proper
MA.J Plastics Co.,LTD [2017-10-16 16:54:59 ]
Professional in BMC/SMC thermoset material production, with 15 years of BMC/SMC material production experience. High production capacity, stable product injection molding. The circuit breaker cover, circuit breaker panel, IMD(Inner mold decoration) of good adhesion, abrasion resi
MA.J Plastics Co.,LTD [2017-10-16 16:52:38 ]
UHF White Card RFID Card Standard 9662 Card UHF RFID Card Passive Electronic Tags Aikeyi Technology WeChat aky_01,Skype 13423626252,QQ 2880179620,WhatsApp 15011978320) RFID Features Frequency 920 ~ 925MHz (can be produced according to the frequency requirements of different count
Guangzhou AIKEYI Smart Card Technology Co.,Ltd. [2017-10-16 15:43:45 ]
RFID dual protocol electronic tag RF card high frequency ultra high frequency combo white card 915Mhz Aikeyi Technology WeChat aky_01,Skype 13423626252,QQ 2880179620,WhatsApp 15011978320) Frequency CPU & 915MHz dual frequency 1. CPU 2. 915MHz EPC Class1 Gen2 Finished size 85.6mmX
Guangzhou AIKEYI Smart Card Technology Co.,Ltd. [2017-10-16 15:42:58 ]
CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on
Creative Peptides [2017-10-16 14:12:09 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAT# R0832 CAS No. 5991-13-9 Sequence RFPSFGPPR M W/Mr. 1060.22 Molecular Formula C50H73N15O11 Storage -20°C We
Creative Peptides [2017-10-16 14:04:11 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ht
Creative Peptides [2017-10-16 14:00:22 ]
FEMA 3236 Odor description A rose, geranium odor with an earthy undertone. Taste description Green, rosy, woody. Purity 99.0% (sum of isomers) Appearance colorless liquid Synonyms 2H-Pyran, tetrahydro-4-methyl-2-(2-methyl-1-propenyl)-, ROSE OXIDE BRI, Tetrahydro-4-methyl-2-(2-met
BOC Sciences [2017-10-16 11:37:11 ]
SX2000 monochrome paperless recorder has max 4-channel universal inputs function. Paperless chart recorder can input the standard current, standard voltage, frequency, millivolt, thermocouple, thermal resistance and other signals. paperless graphic recorder also has some other fu
SILVER AUTOMATION INSTRUMENTS LTD [2017-10-16 11:03:07 ]
SX5000 blue-screen paperless recorder has max 16-channel universal input function. Chartless Recorder can input the standard current, standard voltage, frequency, millivolt, thermocouple, thermal resistance and other signals. It is low cost paperless recorder but with powerful fu
SILVER AUTOMATION INSTRUMENTS LTD [2017-10-16 11:02:22 ]
SX6000 color-screen paperless recorder has max 16-channel universal input function. Chartless Recorder can input the standard current, standard voltage, frequency, millivolt, thermocouple, thermal resistance and other signals. Paperless data recorder also has some other functions
SILVER AUTOMATION INSTRUMENTS LTD [2017-10-16 11:01:35 ]
SX8000 color-screen paperless recorder has 40-channel universal input function. Recorder paperless can input the standard current, standard voltage, frequency, millivolt, thermocouple, thermal resistance and other signals. And it is paperless recorder from china with cheap price.
SILVER AUTOMATION INSTRUMENTS LTD [2017-10-16 11:00:52 ]
