SPECIFICATION Frame Genius Carbon / IMP technology / HMF Mainframe BB92 / Alloy SL 6011 swingarm Virtual 4 Link Design 27.5 (2.6 & 2.8) and 29 (2.4 & 2.6) tire compatible with Geo-BB adj. SW dropouts for Boost 12x148mm TBC Trunnion box construction Fork FOX 34 Float Performance
ARIZASPORT MEDAN [2017-10-18 20:08:33 ]
SPECIFICATION Frame Genius Carbon / IMP technology / HMX / 1x optimized BB92 / Carbon swingarm Virtual 4 Link Design 27.5 (2.6 & 2.8) and 29 (2.4 & 2.6) tire compatible with Geo -BB adj. SW dropouts for Boost 12x148mm TBC Trunnion box construction Fork FOX 34 Float Factory Air /
ARIZASPORT MEDAN [2017-10-18 20:04:37 ]
SPECIFICATION Frame Genius Carbon / IMP technology / HMX / 1x optimized BB92 / Carbon swingarm Virtual 4 Link Design 27.5 (2.6 & 2.8) and 29 (2.4 & 2.6) tire compatible with Geo -BB adj. SW dropouts for Boost 12x148mm TBC Trunnion box construction Fork FOX 36 Float Factory Air /
ARIZASPORT MEDAN [2017-10-18 19:59:41 ]
RK Pipe and Drape offers drapes and curtains, flame retardant and table linen fabrics, drapery linings and trim collections, plus Free Shipping $50+. Crossbar 2\'~26\' Base plate 24\"*24 Upright 3\'~26\' Pipe Material Aluminum Surface Anodizing Drape Chelloffon, Banjo, Poly, Velo
RK Pipe & Drape ltd. [2017-10-18 18:02:32 ]
China Lutong Parts Plant is a professional manufacturer specialized in diesel injection parts for about 25years Pls feel free to contact us if you need any parts Thanks. 7123-340R 4/8.5L DPA 7123-340S 4/8.5R DPA 7123-340U 4/9R DPA 7123-340E 4/8.5L DPA 7139-130T 4/9L DPA 7139-709W
China-Lutong Parts Plant [2017-10-18 16:04:55 ]
Plastic Filter Fan Guard 80MM port shenzhen Brand Name greatcooler MOQ 500PCS Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. Should you have any questions , pls do not hesitate to contact me .
Greatcooler Electronic Technology Co.,LTD [2017-10-18 15:37:21 ]
Anping Tenglu Metal Wire Mesh Co.,LTD Garden Fence It has simple structure, good outlook and easy installation. It is suitable for fencing of mountain land, slope, bending area and various land situations. Specifications 1. Wire fence panel 200x50mm x2.5m Long x Different Height
Anping Tenglu metal Wire Mesh Co.LTD [2017-10-17 20:03:08 ]
We can according to customer’s require to produce kinds of hydraulic gear pump. Customize the replacement Gear Pump of Caproni, Rexroth, Parker, Vickers, etc famous brand. Customize Gear Pump can match with the OEM number parts of all machines. Like John Deere, Massey Ferguson,
Shijiazhuang Hanjiu Technology Co.,Ltd [2017-10-16 17:31:01 ]
Five axis linkage, X/Y/Z axis is linear motor, high speed and high precision. MA J’s history can be traced back to 1994, when our founders commenced to engage in the mold fabrication in China. Through over 20 years of development, MA J has become a one-stop total plastics solut
MA.J Plastics Co.,LTD [2017-10-16 17:10:18 ]
Needle valve hot runner system, each hot nozzle can be independently controlled, time accuracy 0.01 seconds, to ensure that the weight of parts consistent. MA J’s history can be traced back to 1994, when our founders commenced to engage in the mold fabrication in China. Through
MA.J Plastics Co.,LTD [2017-10-16 17:05:40 ]
Professional in BMC/SMC thermoset material production, with 15 years of BMC/SMC material production experience. High production capacity, stable product injection molding. Producing terminals, plastic case, replacing assembly terminals, plastic case using PA material. With resist
MA.J Plastics Co.,LTD [2017-10-16 16:58:23 ]
Plastic Filter Fan Guard 60mm Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any needs , pls feel free contact me .
Greatcooler Electronic Technology Co.,LTD [2017-10-16 16:41:03 ]
120mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler MOQ 500PCS Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment . If you have any needs ， pls feel free contact me .
Greatcooler Electronic Technology Co.,LTD [2017-10-16 16:10:45 ]
90mm Fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment . If you have any needs , pls feel free contact me .
Greatcooler Electronic Technology Co.,LTD [2017-10-16 16:07:28 ]
Custom Ntag213 / 215 White Card, Game Card Design,14443A Agreement White Standard Original NTAG215 Chip NFC Electronic Label NFC Sticker Label Aikeyi Technology WeChat aky_01,Skype 13423626252,QQ 2880179620,WhatsApp 15011978320) Diameter 25mm,or customized Chip Model NTAG 215 Ope
Guangzhou AIKEYI Smart Card Technology Co.,Ltd. [2017-10-16 15:42:14 ]
Creative Peptides offers H-2Db human gp100 tetramer-KVPRNQDWL-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/h-2db-human-gp100-tetramer-kvprnqdwl-apc-labeled-item-cpm-1-0034-33874.html for more infor
Creative Peptides [2017-10-16 14:24:26 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Synonyms/Alias GS peptide-2 CAS No. 851366-97-7 Sequence YRRAAVPPSPSLSRHSSPHQSEDEEE (Modifications Ser-21 = OPO3H
Creative Peptides [2017-10-16 14:13:43 ]
80mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any interest pls feel free contact me .
Greatcooler Electronic Technology Co.,LTD [2017-10-16 14:12:47 ]
CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on
Creative Peptides [2017-10-16 14:12:09 ]
4mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any needs , pls feel free contact me .
Greatcooler Electronic Technology Co.,LTD [2017-10-16 14:09:56 ]
