alpha:g* - Manufacturers, Suppliers & Exporters
Plastic Filter Fan Guard 80MM port shenzhen Brand Name greatcooler MOQ 500PCS Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. Should you have any questions , pls do not hesitate to contact me .
Greatcooler Electronic Technology Co.,LTD [2017-10-18 15:37:21 ]
Anping Tenglu Metal Wire Mesh Co.,LTD Garden Fence It has simple structure, good outlook and easy installation. It is suitable for fencing of mountain land, slope, bending area and various land situations. Specifications 1. Wire fence panel 200x50mm x2.5m Long x Different Height
Anping Tenglu metal Wire Mesh Co.LTD [2017-10-17 20:03:08 ]
We can according to customer’s require to produce kinds of hydraulic gear pump. Customize the replacement Gear Pump of Caproni, Rexroth, Parker, Vickers, etc famous brand. Customize Gear Pump can match with the OEM number parts of all machines. Like John Deere, Massey Ferguson,
Shijiazhuang Hanjiu Technology Co.,Ltd [2017-10-16 17:31:01 ]
Five axis linkage, X/Y/Z axis is linear motor, high speed and high precision. MA J’s history can be traced back to 1994, when our founders commenced to engage in the mold fabrication in China. Through over 20 years of development, MA J has become a one-stop total plastics solut
MA.J Plastics Co.,LTD [2017-10-16 17:10:18 ]
Needle valve hot runner system, each hot nozzle can be independently controlled, time accuracy 0.01 seconds, to ensure that the weight of parts consistent. MA J’s history can be traced back to 1994, when our founders commenced to engage in the mold fabrication in China. Through
MA.J Plastics Co.,LTD [2017-10-16 17:05:40 ]
Professional in BMC/SMC thermoset material production, with 15 years of BMC/SMC material production experience. High production capacity, stable product injection molding. Producing terminals, plastic case, replacing assembly terminals, plastic case using PA material. With resist
MA.J Plastics Co.,LTD [2017-10-16 16:58:23 ]
Plastic Filter Fan Guard 60mm Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any needs , pls feel free contact me .
Greatcooler Electronic Technology Co.,LTD [2017-10-16 16:41:03 ]
120mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler MOQ 500PCS Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment . If you have any needs ， pls feel free contact me .
Greatcooler Electronic Technology Co.,LTD [2017-10-16 16:10:45 ]
Custom Ntag213 / 215 White Card, Game Card Design,14443A Agreement White Standard Original NTAG215 Chip NFC Electronic Label NFC Sticker Label Aikeyi Technology WeChat aky_01,Skype 13423626252,QQ 2880179620,WhatsApp 15011978320) Diameter 25mm,or customized Chip Model NTAG 215 Ope
Guangzhou AIKEYI Smart Card Technology Co.,Ltd. [2017-10-16 15:42:14 ]
Creative Peptides offers H-2Db human gp100 tetramer-KVPRNQDWL-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/h-2db-human-gp100-tetramer-kvprnqdwl-apc-labeled-item-cpm-1-0034-33874.html for more infor
Creative Peptides [2017-10-16 14:24:26 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Synonyms/Alias GS peptide-2 CAS No. 851366-97-7 Sequence YRRAAVPPSPSLSRHSSPHQSEDEEE (Modifications Ser-21 = OPO3H
Creative Peptides [2017-10-16 14:13:43 ]
80mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any interest pls feel free contact me .
Greatcooler Electronic Technology Co.,LTD [2017-10-16 14:12:47 ]
CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on
Creative Peptides [2017-10-16 14:12:09 ]
4mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any needs , pls feel free contact me .
Greatcooler Electronic Technology Co.,LTD [2017-10-16 14:09:56 ]
Item Specifications Product Name Steel cabinet Brand Feng Long Model SC-L1 Dimension H900mm*W400mm*D900mm, per customer`s requirement Packing Volume 0.093CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office furnitur
LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD [2017-10-16 14:07:55 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAT#R083
Creative Peptides [2017-10-16 14:03:19 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAT#R082
Creative Peptides [2017-10-16 14:01:32 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ht
Creative Peptides [2017-10-16 13:56:36 ]
CAS Number 49557-75-7 Synonyms GHK Cu Copper Peptide Molecular Weight 340.39 Molecular Formula C14H24N6O4 Description Whitening and removing wrinkles Alfa Chemistry offers an extensive catalog of building blocks, reagents, catalysts, reference materials, and research chemicals. W
Alfa Chemistry [2017-10-16 13:47:55 ]
Alfa Chemistry offers an extensive catalog of building blocks, reagents, catalysts, reference materials, and research chemicals. We supply Amygdalin. More information please visit the website https://www alfa-chemistry com/genistein-cas-446-72-0-item-284864.htm CAS Number 446-72-
Alfa Chemistry [2017-10-16 13:47:22 ]
