dermaroller microneedling skin roller with 540 needles 540 needles in total Needle Material Stainless Steel Needle Length 0.2/0.25/0.3/0.5/0.75/1.0/1.5/2.0/2.5/3.0mm Handle Material Plastic Handle Color Whtite/Black Roller Material Medical Silicone Roller Color Black/Red/Blue How
iTech Aesthetics Limited [2017-10-17 13:53:59 ]
Cryotherapy Freezefat Coolsculpting Cryolipolysis Machine With 3 Handles Weight Loss Slimming Salon Beauty Equipment 1.Product Pictures WORKING PRINCIPAL-------- Cryolipolysis cool shape machine is a new, non-invasive way to gently and effectively reduce fat in targeted areas of
iTech Aesthetics Limited [2017-10-17 12:05:11 ]
Cryolipolysis Coolsculpting Cooling With 4 Handles Fat Freezing Beauty Machine For Slimming 1.Product description Cryolipolysis cool shape machine is a new, noninvasive way to gently and effectively reduce fat in targeted areas of the body that results in a noticeable, naturalloo
iTech Aesthetics Limited [2017-10-17 12:00:22 ]
Spherical Roller Bearing Part No. 24048BC3W33, Inner Ring 240.000mm, Outer Ring 360.000mm, Width 118.000mm, Chamfer 3, Basic Dynamic Load Rating 1499KN, Basic Static Load Rating 2970KN, Limited Speed (rpm) 864(grease)/1120(oil), Gross Weight 46.8kg, Brass Cage Equipped with an ou
Cojinete Bearings Co., Ltd [2017-10-17 10:09:31 ]
Single Row Tapered Roller Bearing 32940, Inner Ring 200.000mm, Outer Ring 280.000mm, Width 51.000mm, Width of Inner Ring 51.000mm, Width of Outer Ring 39.000mm, Chamfer of Inner Ring 3mm, Chamfer of Outer Ring 2.5mm, Basic Dynamic Load Rating 460KN, Basic Static Load Rating 950KN
Cojinete Bearings Co., Ltd [2017-10-16 19:09:57 ]
This is Hanjiu Hydraulic from Shijiazhuang Hanjiu Technology Co.,Ltd,we mainly produce Hydraulic orbitrol steering. Our orbitrol steering can widely used for kinds of Agricultural equipments like Agricultural harvesters,tractors for John Deere,New Holland,Case,Class,JCB etc. Our
Shijiazhuang Hanjiu Technology Co.,Ltd [2017-10-16 17:26:45 ]
BMM series motor are small volume,economical type,which is designed with shaft distribution flow, which adapt the Gerotor gear set design and provide compact volume,high power and low weigth. Characteristic features * Advanced manufacturing devices for the Gerotor gear set, which
Shijiazhuang Hanjiu Technology Co.,Ltd [2017-10-16 17:16:23 ]
Hydraulic orbit motor BMV BMV series motor adapt the advanced Gerotor gear set, design with disc distribution flow and high pressure. The unit can be supplied theindividual variant in operating multifunction in accordance with requirement of applications. Characteristic Features
Shijiazhuang Hanjiu Technology Co.,Ltd [2017-10-16 17:14:07 ]
Plastic Filter Fan Guard 60mm Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any needs , pls feel free contact me .
Greatcooler Electronic Technology Co.,LTD [2017-10-16 16:41:03 ]
120mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler MOQ 500PCS Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment . If you have any needs , pls feel free contact me .
Greatcooler Electronic Technology Co.,LTD [2017-10-16 16:10:45 ]
Custom Ntag213 / 215 White Card, Game Card Design,14443A Agreement White Standard Original NTAG215 Chip NFC Electronic Label NFC Sticker Label Aikeyi Technology WeChat aky_01,Skype 13423626252,QQ 2880179620,WhatsApp 15011978320) Diameter 25mm,or customized Chip Model NTAG 215 Ope
Guangzhou AIKEYI Smart Card Technology Co.,Ltd. [2017-10-16 15:42:14 ]
Luoyang Iron King Trading Co., Ltd. Is a office furniture factory was established in 2 0 1 1. It is a professional metal furniture factory which is located in Luoyang, China. Iron King factory covers over 5, 3 0 0 square meters. Iron King group owns more than 6 0 skillful workers
LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD [2017-10-16 14:42:58 ]
Features 1 HD 960P(1280*960), 1.3 MP, H.264. 2 Night Vision Adopt new starlight level sensor, with shimmer night visioin is full color, IR distance 20M. 3 Lens 4mm, F16 Starlight level Lens with better ngith vision. 4 microSD Card Supports upto 64GB microSD card for recording and
Shenzhen Sricctv Technology Co.Ltd. [2017-10-16 14:26:22 ]
Creative Peptides offers H-2Db human gp100 tetramer-KVPRNQDWL-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/h-2db-human-gp100-tetramer-kvprnqdwl-apc-labeled-item-cpm-1-0034-33874.html for more infor
Creative Peptides [2017-10-16 14:24:26 ]
Creative Peptides offers HLA-E_01_03 HLA-A leader3-11 tetramer-VMAPRTLVL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-e-hla-a-leader3-tetramer-vmaprtlvl-pe-labeled-item-cpm-1-0037-33877.html for
Creative Peptides [2017-10-16 14:21:07 ]
Creative Peptides offers HLA-A_11_01 EBV EBNA3B 416-424 tetramer-IVTDFSVIK-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-ebv-ebna3b-tetramer-ivtdfsvik-pe-labeled-item-cpm-1-0038-33878.html for
Creative Peptides [2017-10-16 14:20:40 ]
Creative Peptides offers H-2Ld HBsAg tetramer-IPQSLDSWWTSL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/h-2ld-hbsag-tetramer-ipqsldswwtsl-pe-labeled-item-cpm-1-0039-33879.html for more information.
Creative Peptides [2017-10-16 14:18:15 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Synonyms/Alias GS peptide-2 CAS No. 851366-97-7 Sequence YRRAAVPPSPSLSRHSSPHQSEDEEE (Modifications Ser-21 = OPO3H
Creative Peptides [2017-10-16 14:13:43 ]
80mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any interest pls feel free contact me .
Greatcooler Electronic Technology Co.,LTD [2017-10-16 14:12:47 ]
CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on
Creative Peptides [2017-10-16 14:12:09 ]