Searching alpha:[0* TO 9*] , total 279015 products,queries done in 202 ms
Dermaroller Microneedling Skin Roller with 540 Needles

dermaroller microneedling skin roller with 540 needles 540 needles in total Needle Material Stainless Steel Needle Length 0.2/0.25/0.3/0.5/0.75/1.0/1.5/2.0/2.5/3.0mm Handle Material Plastic Handle Color Whtite/Black Roller Material Medical Silicone Roller Color Black/Red/Blue How

iTech Aesthetics Limited      [2017-10-17 13:53:59 ]

Cryotherapy Freezefat Coolsculpting Cryolipolysis Machine with 3 Handles Weight Loss Slimming Salon Beauty Equipment

Cryotherapy Freezefat Coolsculpting Cryolipolysis Machine With 3 Handles Weight Loss Slimming Salon Beauty Equipment 1.Product Pictures WORKING PRINCIPAL-------- Cryolipolysis cool shape machine is a new, non-invasive way to gently and effectively reduce fat in targeted areas of

iTech Aesthetics Limited      [2017-10-17 12:05:11 ]

Cryolipolysis Coolsculpting Cooling with 4 Handles Fat Freezing Beauty Machine for Slimming

Cryolipolysis Coolsculpting Cooling With 4 Handles Fat Freezing Beauty Machine For Slimming 1.Product description Cryolipolysis cool shape machine is a new, noninvasive way to gently and effectively reduce fat in targeted areas of the body that results in a noticeable, naturalloo

iTech Aesthetics Limited      [2017-10-17 12:00:22 ]

Spherical Roller Bearing 24048BC3W33

Spherical Roller Bearing Part No. 24048BC3W33, Inner Ring 240.000mm, Outer Ring 360.000mm, Width 118.000mm, Chamfer 3, Basic Dynamic Load Rating 1499KN, Basic Static Load Rating 2970KN, Limited Speed (rpm) 864(grease)/1120(oil), Gross Weight 46.8kg, Brass Cage Equipped with an ou

Cojinete Bearings Co., Ltd      [2017-10-17 10:09:31 ]

Single Row Tapered Roller Bearing 32940

Single Row Tapered Roller Bearing 32940, Inner Ring 200.000mm, Outer Ring 280.000mm, Width 51.000mm, Width of Inner Ring 51.000mm, Width of Outer Ring 39.000mm, Chamfer of Inner Ring 3mm, Chamfer of Outer Ring 2.5mm, Basic Dynamic Load Rating 460KN, Basic Static Load Rating 950KN

Cojinete Bearings Co., Ltd      [2017-10-16 19:09:57 ]

Orbitrol 060

This is Hanjiu Hydraulic from Shijiazhuang Hanjiu Technology Co.,Ltd,we mainly produce Hydraulic orbitrol steering. Our orbitrol steering can widely used for kinds of Agricultural equipments like Agricultural harvesters,tractors for John Deere,New Holland,Case,Class,JCB etc. Our

Shijiazhuang Hanjiu Technology Co.,Ltd      [2017-10-16 17:26:45 ]

Orbital Hydraulic Motor Bmm-8/Bmm-12

BMM series motor are small volume,economical type,which is designed with shaft distribution flow, which adapt the Gerotor gear set design and provide compact volume,high power and low weigth. Characteristic features * Advanced manufacturing devices for the Gerotor gear set, which

Shijiazhuang Hanjiu Technology Co.,Ltd      [2017-10-16 17:16:23 ]

Orbital Hydraulic Motor Bmv-315/Bmv-400

Hydraulic orbit motor BMV BMV series motor adapt the advanced Gerotor gear set, design with disc distribution flow and high pressure. The unit can be supplied theindividual variant in operating multifunction in accordance with requirement of applications. Characteristic Features

Shijiazhuang Hanjiu Technology Co.,Ltd      [2017-10-16 17:14:07 ]

Plastic Filter Fan Guard 60mm

Plastic Filter Fan Guard 60mm Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any needs , pls feel free contact me .

Greatcooler Electronic Technology Co.,LTD      [2017-10-16 16:41:03 ]

120mm fan metal guard

120mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler MOQ 500PCS Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment . If you have any needs , pls feel free contact me .

Greatcooler Electronic Technology Co.,LTD      [2017-10-16 16:10:45 ]

Custom Ntag213 / 215 White Card, Game Card Design,14443A Agreement White Standard Original NTAG215 Chip NFC Electronic Label NFC Sticker Label Aikeyi Technology

Custom Ntag213 / 215 White Card, Game Card Design,14443A Agreement White Standard Original NTAG215 Chip NFC Electronic Label NFC Sticker Label Aikeyi Technology WeChat aky_01,Skype 13423626252,QQ 2880179620,WhatsApp 15011978320) Diameter 25mm,or customized Chip Model NTAG 215 Ope

Guangzhou AIKEYI Smart Card Technology Co.,Ltd.      [2017-10-16 15:42:14 ]

Aluminum alloy clasp hands 4 drawers steel office cabinet

Luoyang Iron King Trading Co., Ltd. Is a office furniture factory was established in 2 0 1 1. It is a professional metal furniture factory which is located in Luoyang, China. Iron King factory covers over 5, 3 0 0 square meters. Iron King group owns more than 6 0 skillful workers

LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD      [2017-10-16 14:42:58 ]

Sricam SP023 Night Vision with Full color H.264 HD720P Waterproof outdoor Bullet IP camera

Features 1 HD 960P(1280*960), 1.3 MP, H.264. 2 Night Vision Adopt new starlight level sensor, with shimmer night visioin is full color, IR distance 20M. 3 Lens 4mm, F16 Starlight level Lens with better ngith vision. 4 microSD Card Supports upto 64GB microSD card for recording and

Shenzhen Sricctv Technology Co.Ltd.      [2017-10-16 14:26:22 ]

H-2Db human gp100 tetramer-KVPRNQDWL-APC labeled

Creative Peptides offers H-2Db human gp100 tetramer-KVPRNQDWL-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/h-2db-human-gp100-tetramer-kvprnqdwl-apc-labeled-item-cpm-1-0034-33874.html for more infor

Creative Peptides      [2017-10-16 14:24:26 ]

HLA-E_01_03 HLA-A leader3-11 tetramer-VMAPRTLVL-PE labeled

Creative Peptides offers HLA-E_01_03 HLA-A leader3-11 tetramer-VMAPRTLVL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-e-hla-a-leader3-tetramer-vmaprtlvl-pe-labeled-item-cpm-1-0037-33877.html for

Creative Peptides      [2017-10-16 14:21:07 ]

HLA-A_11_01 EBV EBNA3B 416-424 tetramer-IVTDFSVIK-PE labeled

Creative Peptides offers HLA-A_11_01 EBV EBNA3B 416-424 tetramer-IVTDFSVIK-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-ebv-ebna3b-tetramer-ivtdfsvik-pe-labeled-item-cpm-1-0038-33878.html for

Creative Peptides      [2017-10-16 14:20:40 ]

H-2Ld HBsAg tetramer-IPQSLDSWWTSL-PE labeled

Creative Peptides offers H-2Ld HBsAg tetramer-IPQSLDSWWTSL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/h-2ld-hbsag-tetramer-ipqsldswwtsl-pe-labeled-item-cpm-1-0039-33879.html for more information.

Creative Peptides      [2017-10-16 14:18:15 ]

Phospho-Glycogen Synthase Peptide-2 (substrate)

We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Synonyms/Alias GS peptide-2 CAS No. 851366-97-7 Sequence YRRAAVPPSPSLSRHSSPHQSEDEEE (Modifications Ser-21 = OPO3H

Creative Peptides      [2017-10-16 14:13:43 ]

80mm fan metal guard

80mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any interest pls feel free contact me .

Greatcooler Electronic Technology Co.,LTD      [2017-10-16 14:12:47 ]

GLP-2 (rat)

CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on

Creative Peptides      [2017-10-16 14:12:09 ]