Searching alpha:[0* TO 9*] , total 380127 products,queries done in 36 ms
H-2Db human gp100 tetramer-KVPRNQDWL-APC labeled

Creative Peptides offers H-2Db human gp100 tetramer-KVPRNQDWL-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/h-2db-human-gp100-tetramer-kvprnqdwl-apc-labeled-item-cpm-1-0034-33874.html for more infor

Creative Peptides      [2017-10-16 14:24:26 ]

HLA-E_01_03 HLA-A leader3-11 tetramer-VMAPRTLVL-PE labeled

Creative Peptides offers HLA-E_01_03 HLA-A leader3-11 tetramer-VMAPRTLVL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-e-hla-a-leader3-tetramer-vmaprtlvl-pe-labeled-item-cpm-1-0037-33877.html for

Creative Peptides      [2017-10-16 14:21:07 ]

HLA-A_11_01 EBV EBNA3B 416-424 tetramer-IVTDFSVIK-PE labeled

Creative Peptides offers HLA-A_11_01 EBV EBNA3B 416-424 tetramer-IVTDFSVIK-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-ebv-ebna3b-tetramer-ivtdfsvik-pe-labeled-item-cpm-1-0038-33878.html for

Creative Peptides      [2017-10-16 14:20:40 ]

H-2Ld HBsAg tetramer-IPQSLDSWWTSL-PE labeled

Creative Peptides offers H-2Ld HBsAg tetramer-IPQSLDSWWTSL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/h-2ld-hbsag-tetramer-ipqsldswwtsl-pe-labeled-item-cpm-1-0039-33879.html for more information.

Creative Peptides      [2017-10-16 14:18:15 ]

Phospho-Glycogen Synthase Peptide-2 (substrate)

We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Synonyms/Alias GS peptide-2 CAS No. 851366-97-7 Sequence YRRAAVPPSPSLSRHSSPHQSEDEEE (Modifications Ser-21 = OPO3H

Creative Peptides      [2017-10-16 14:13:43 ]

80mm fan metal guard

80mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any interest pls feel free contact me .

Greatcooler Electronic Technology Co.,LTD      [2017-10-16 14:12:47 ]

GLP-2 (rat)

CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on

Creative Peptides      [2017-10-16 14:12:09 ]

3 drawers Aluminum alloy clasp hands steel file cabinet

Product Name Filing cabinet Brand Feng Long Model FC-N3-3 Dimension H1031mm*W452mm*D620mm, per customer`s requirement Packing Volume 0.069CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office furniture Port Qingdao,S

LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD      [2017-10-16 14:11:15 ]

4mm fan metal guard

4mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any needs , pls feel free contact me .

Greatcooler Electronic Technology Co.,LTD      [2017-10-16 14:09:56 ]

LEP (116-130) (mouse)

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. More information please visit our website https://www creative-peptides com/product/lep-mouse-item-r0836-34638.html CAT#R0836 CAS No.258276-95-8 SequenceSCSLPQTSGLQKPES (Modif

Creative Peptides      [2017-10-16 14:09:27 ]

2 doors hang the garment bag integrated ark metal steel cabinet

Item Specifications Product Name Steel cabinet Brand Feng Long Model SC-L1 Dimension H900mm*W400mm*D900mm, per customer`s requirement Packing Volume 0.093CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office furnitur

LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD      [2017-10-16 14:07:55 ]

apoE(133-149)

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAS No.5

Creative Peptides      [2017-10-16 14:02:26 ]

GR 231118

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAT#R082

Creative Peptides      [2017-10-16 14:01:32 ]

MLCK inhibitor peptide 18

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ht

Creative Peptides      [2017-10-16 13:59:23 ]

CYN 154806

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ht

Creative Peptides      [2017-10-16 13:52:17 ]

(3aR)-(+)-Sclareolide

CAS Number 564-20-5 Synonyms (+)-Norambreinolide Molecular Weight 250.38 Molecular Formula C16H26O2 Purity 98%+ (HPLC) Appearance off-white to White crystal powder Alfa Chemistry offers an extensive catalog of building blocks, reagents, catalysts, reference materials, and researc

Alfa Chemistry      [2017-10-16 13:44:19 ]

2-Acetylfuran

Alfa Chemistry offers an extensive catalog of building blocks, reagents, catalysts, reference materials, and research chemicals. We supply Charantin,Bitter Melon P E. More information please visit the website https://www alfa-chemistry com/2-acetylfuran-cas-1192-62-7-item-295818.

Alfa Chemistry      [2017-10-16 13:34:16 ]

5-METHYL FURFURAL

2-Furancarboxaldehyde, 5-methyl-, 5-METHYL FURFURAL, 5-Methyl-2-furaldehyde, 5-Methylfurfural BOC Sciences is committed to supplying cost-effective products and services. We provide 5-METHYL FURFURAL. More information please visit https://www bocsci com/5-methyl-furfural-cas-620-

BOC Sciences      [2017-10-16 11:46:53 ]

cis-3-HEXENYL LACTATE

C-3-HEXENYL LACTATE, cis-3-HEXENYL LACTATE, Propanoic acid, 2-hydroxy-, (3Z)-3-hexenyl ester, Z-3-Hexenyl lactate, cis-3-HEXENYL LACTATE NO ANTIOXIDANT (special order) BOC Sciences is committed to supplying cost-effective products and services. We provide cis-3-HEXENYL LACTATE. M

BOC Sciences      [2017-10-16 11:45:58 ]

1-PENTEN-3-OL, (ETHYL VINYL CARBINOL)

BOC Sciences is committed to supplying cost-effective products and services. We provide 1-PENTEN-3-OL, (ETHYL VINYL CARBINOL). More information please visit https://www bocsci com/1-penten-3-ol-ethyl-vinyl-carbinol-cas-616-25-1-item-73239.html 1-Penten-3-ol, 1-PENTEN-3-OL, (ETHYL

BOC Sciences      [2017-10-16 11:45:28 ]