Email ....... kathy@wh-wanli com Skype ........rcwanli@outlook com We provide and export high quality and purity research chemicals in large and small quantities ... our products is as below Our products are of high purity (above 99%).( Please email to kathy@wh-wanli com) 4MEC,BK
WUHAN Manley Biological Co.,ltd [2017-10-16 14:54:13 ]
Luoyang Iron King Trading Co., Ltd. Is a office furniture factory was established in 2 0 1 1. It is a professional metal furniture factory which is located in Luoyang, China. Iron King factory covers over 5, 3 0 0 square meters. Iron King group owns more than 6 0 skillful workers
LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD [2017-10-16 14:42:58 ]
Features 1 HD 960P(1280*960), 1.3 MP, H.264. 2 Night Vision Adopt new starlight level sensor, with shimmer night visioin is full color, IR distance 20M. 3 Lens 4mm, F16 Starlight level Lens with better ngith vision. 4 microSD Card Supports upto 64GB microSD card for recording and
Shenzhen Sricctv Technology Co.Ltd. [2017-10-16 14:26:22 ]
Creative Peptides offers H-2Db human gp100 tetramer-KVPRNQDWL-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/h-2db-human-gp100-tetramer-kvprnqdwl-apc-labeled-item-cpm-1-0034-33874.html for more infor
Creative Peptides [2017-10-16 14:24:26 ]
Creative Peptides offers HLA-E_01_03 HLA-A leader3-11 tetramer-VMAPRTLVL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-e-hla-a-leader3-tetramer-vmaprtlvl-pe-labeled-item-cpm-1-0037-33877.html for
Creative Peptides [2017-10-16 14:21:07 ]
Creative Peptides offers HLA-A_11_01 EBV EBNA3B 416-424 tetramer-IVTDFSVIK-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-ebv-ebna3b-tetramer-ivtdfsvik-pe-labeled-item-cpm-1-0038-33878.html for
Creative Peptides [2017-10-16 14:20:40 ]
Creative Peptides offers H-2Ld HBsAg tetramer-IPQSLDSWWTSL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/h-2ld-hbsag-tetramer-ipqsldswwtsl-pe-labeled-item-cpm-1-0039-33879.html for more information.
Creative Peptides [2017-10-16 14:18:15 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Synonyms/Alias GS peptide-2 CAS No. 851366-97-7 Sequence YRRAAVPPSPSLSRHSSPHQSEDEEE (Modifications Ser-21 = OPO3H
Creative Peptides [2017-10-16 14:13:43 ]
80mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any interest pls feel free contact me .
Greatcooler Electronic Technology Co.,LTD [2017-10-16 14:12:47 ]
CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on
Creative Peptides [2017-10-16 14:12:09 ]
Product Name Filing cabinet Brand Feng Long Model FC-N3-3 Dimension H1031mm*W452mm*D620mm, per customer`s requirement Packing Volume 0.069CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office furniture Port Qingdao,S
LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD [2017-10-16 14:11:15 ]
4mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any needs , pls feel free contact me .
Greatcooler Electronic Technology Co.,LTD [2017-10-16 14:09:56 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. More information please visit our website https://www creative-peptides com/product/lep-mouse-item-r0836-34638.html CAT#R0836 CAS No.258276-95-8 SequenceSCSLPQTSGLQKPES (Modif
Creative Peptides [2017-10-16 14:09:27 ]
Item Specifications Product Name Steel cabinet Brand Feng Long Model SC-L1 Dimension H900mm*W400mm*D900mm, per customer`s requirement Packing Volume 0.093CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office furnitur
LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD [2017-10-16 14:07:55 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAS No.5
Creative Peptides [2017-10-16 14:02:26 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAT#R082
Creative Peptides [2017-10-16 14:01:32 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ht
Creative Peptides [2017-10-16 13:59:23 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ht
Creative Peptides [2017-10-16 13:52:17 ]
CAS Number 564-20-5 Synonyms (+)-Norambreinolide Molecular Weight 250.38 Molecular Formula C16H26O2 Purity 98%+ (HPLC) Appearance off-white to White crystal powder Alfa Chemistry offers an extensive catalog of building blocks, reagents, catalysts, reference materials, and researc
Alfa Chemistry [2017-10-16 13:44:19 ]
Alfa Chemistry offers an extensive catalog of building blocks, reagents, catalysts, reference materials, and research chemicals. We supply Charantin,Bitter Melon P E. More information please visit the website https://www alfa-chemistry com/2-acetylfuran-cas-1192-62-7-item-295818.
Alfa Chemistry [2017-10-16 13:34:16 ]
