Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Formula C43H66N12O12S2 Synonyms 3-Isoleucine-8-leucine vasopressin;Alpha-hypophamine;Atonin O;Di-sipidin;Endopituitrina;Hyphotocin;Intertocine S;Nobitocin S;Orasthin;Partocon;Perlacton;Pitoc
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:58:55 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-G
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:58:01 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Hexarelin Synonyms HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE RELEASING HEXAPEPTIDE;Examorelin;Hexareline;L-Histidyl-2-methyl
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:55:45 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Ipamorelin Sequence Aib-His-D-2-Nal-D-Phe-Lys-NH2 Cas No. 170851-70-4 Purity (HPLC) 98.0% Molecular Formula C38H49N905 Molecular Weight 712.03 Single Impurity (HPLC) 0.5%max Amino Acid Compo
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:54:53 ]
Advantage 1.High invert efficiency and rapid start; 2.Great physical performance; 3.Low self-discharge rate; 4.Reasonable price; 5.Professional Li-battery customization. No Item Condition Specification 1 /capability /Capacity 14Ah /Minimum Capacity 14.7Ah 2 /Rating Voltage 36±0.
Shenzhen Believe Technology Co.,Ltd [2016-12-12 14:42:10 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com GHRP-6 (Growth hormone releasing peptide) Alias GROWTH HORMONE RELEASING PEPTIDE-6; [HIS1, LYS6]-GHRP; HIS-D-TRP-ALA-TRP-D-PHE-LYS-NH2; H-HIS-D-TRP-ALA-TRP-D-PHE-LYS-NH2 CAS 87616-84-0 Purit
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:37:48 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Quick Detail Product Name GHRP-2 Growth Hormone Releasing Peptide 2 GHRP Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular formula C45H55N9O6 Molar Mass 817.9 CAS number 158861-67-7 P
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:36:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com MT-2 Product Name Melanotan II, MT- II split into vivals, MT2 supplier, Melanotan II manufacturer MT2 Another Name Melanotan II; AC-NLE-CYCLO(-BETA-ASP-HIS-D-PHE-ARG-TRP-EPSILON-LYS-NH2); Me
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:35:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name PT-141 Synonyms BREMELANOTIDE;Brmelanotice;Ac-Nle-cyclo(-Asp-His-D-Phe-Arg-Trp-Lys)-OH;Bremelanotide, PT141,PT-141;BREMELANOTIDE PT141;N-Acetyl-L-norleucyl-L-alpha-aspartyl-L-hi
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:30:16 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com CJC-1295 Alias CJC-1295 Acetate; CJC1295(Without DAC); Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys (Mal
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:28:33 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com CJC-1295 DAC (Drug Affinity Complex) Alias CJC1295(GHRH/DAC) Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Ly
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:27:44 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com PEG-MGF Alias PEG-Suc-YQPPSTNKNTKSQ(d)R(d)RKGSTFEEHK-NH2; PEG-Suc-Tyr-Gln-PRO-PRO-Ser-Thr-Asn-Thr-Lys-Ser-Gln-D-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-His-Lys-NH2 M F. C121H200N42O39 Purity (HPLC)
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:24:20 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Assay 2mg/Vial, 10Vials/Kit MOQ 10Vials Price 10USD/Vial Assay 2mg/Vial, 10Vials/Kit MOQ 10Vials Price 10USD/Vial PEG-MGF Alias PEG-Suc-YQPPSTNKNTKSQ(d)R(d)RKGSTFEEHK-NH2; PEG-Suc-Tyr-Gln-PR
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:23:18 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Pregabalin CAS 148553-50-8 MF C8H17NO2 MW 159.23 mp 194-196°C storage temp. Store at RT Chemical Properties Off-White Solid Usage S-Enantiomer of Pregabalin. A GABA analogue used as an anti
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:20:21 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name 1,3-Dimethylpentylamine hydrochloride Key words 1,3-Dimethylpentylamine hydrochloride,1,3-Dimethylpentylamine hydrochloride,DMAA hcl,DMAA hcl,DMAA hcl Synonyms 4-Methyl-2-hexana
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:18:42 ]
we have produced and exported all kinds of mooring bollard to over 30 countries for years, as following 1.General mooring bollard 2.implanted mooring bollard 3.simple mooring bollard 4.double-cross bolt-fixed mooring bollard 5.double-cross welding-fixed mooring bollard
Jiangsu Wusheng Technology Corp.,Ltd [2016-12-12 13:37:46 ]
Product description Our company professional produces marine manhole cover There are 5 types for clients to choose from,such as A,B,C,D and E This product is mainly applicable to marine water-tight or oil-tight manhole cover but not to boiler and pressure tank Based on the shape,
Jiangsu Wusheng Technology Corp.,Ltd [2016-12-12 13:36:07 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Phenacetin Another Name 1-acetamido-4-ethoxybenzene; para-Acetophenetidide; p-acetophenetidine; p-acetophenetide; p-acetphenetidin; paracetophentidin; p-Ethoxyacetanilide; 4\'-ethoxyacetanil
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 13:34:42 ]
Description Our company professionally produces marine hatch cover mainly used in different kinds of ocean vessels as small size steel hatch cover There are mainly 6 types for clients to choose from,such as A,B,C,D,E,F Also customization is supported according to clients’ reque
Jiangsu Wusheng Technology Corp.,Ltd [2016-12-12 13:18:54 ]
wheel pair for mining electric locomotive Wheel pair wheel pair for locomotive,2016 hotsale wheel pair for mining locomotive, CE wheel pair
HUNAN SOUTH ELECTRIC LOCOMOTIVE CO.,LTD [2016-12-12 13:04:34 ]
