Creative Peptides offers HLA-A_24_02 HBV pol tetramer-KYTSFPWLL-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-hbv-pol-tetramer-kytsfpwll-apc-labeled-item-cpm-1-0033-33873.html for more informa
Creative Peptides [2017-10-16 14:25:35 ]
Creative Peptides offers H-2Db human gp100 tetramer-KVPRNQDWL-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/h-2db-human-gp100-tetramer-kvprnqdwl-apc-labeled-item-cpm-1-0034-33874.html for more infor
Creative Peptides [2017-10-16 14:24:26 ]
Creative Peptides offers HLA-A_01_01 CMV pp50 tetramer-VTEHDTLLY-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-cmv-pp50-tetramer-vtehdtlly-apc-labeled-item-cpm-1-0035-33875.html for more infor
Creative Peptides [2017-10-16 14:23:37 ]
Creative Peptides offers HLA-A_24_02 hTERT tetramer-VYGFVRACL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-htert-tetramer-vygfvracl-pe-labeled-item-cpm-1-0036-33876.html for more information.
Creative Peptides [2017-10-16 14:23:10 ]
Creative Peptides offers HLA-E_01_03 HLA-A leader3-11 tetramer-VMAPRTLVL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-e-hla-a-leader3-tetramer-vmaprtlvl-pe-labeled-item-cpm-1-0037-33877.html for
Creative Peptides [2017-10-16 14:21:07 ]
Creative Peptides offers HLA-A_11_01 EBV EBNA3B 416-424 tetramer-IVTDFSVIK-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-ebv-ebna3b-tetramer-ivtdfsvik-pe-labeled-item-cpm-1-0038-33878.html for
Creative Peptides [2017-10-16 14:20:40 ]
Creative Peptides offers H-2Ld HBsAg tetramer-IPQSLDSWWTSL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/h-2ld-hbsag-tetramer-ipqsldswwtsl-pe-labeled-item-cpm-1-0039-33879.html for more information.
Creative Peptides [2017-10-16 14:18:15 ]
Creative Peptides offers HLA-A_11_01 CMV pp65 tetramer-ATVQGQNLK-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-cmv-pp65-tetramer-atvqgqnlk-pe-labeled-item-cpm-1-0040-33880.html for more informa
Creative Peptides [2017-10-16 14:16:28 ]
Product Name steel almirah designs metal clothes locker cabinet Brand Feng Long Model SL-A2-2 Dimension H1850mm*W380mm*D450mm, per customer`s requirement Packing Volume 0.05CBM Quantity /20GP 560 PCS Quantity /40HQ 1360 PCS Steel Thickness 0.6mm as regular, 0.5-1.2mm available Fu
LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD [2017-10-16 14:15:59 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. Sequence
Creative Peptides [2017-10-16 14:14:40 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Synonyms/Alias GS peptide-2 CAS No. 851366-97-7 Sequence YRRAAVPPSPSLSRHSSPHQSEDEEE (Modifications Ser-21 = OPO3H
Creative Peptides [2017-10-16 14:13:43 ]
80mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any interest pls feel free contact me .
Greatcooler Electronic Technology Co.,LTD [2017-10-16 14:12:47 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We provi
Creative Peptides [2017-10-16 14:12:46 ]
CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on
Creative Peptides [2017-10-16 14:12:09 ]
Product Name Filing cabinet Brand Feng Long Model FC-N3-3 Dimension H1031mm*W452mm*D620mm, per customer`s requirement Packing Volume 0.069CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office furniture Port Qingdao,S
LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD [2017-10-16 14:11:15 ]
Sequence KRMKVAKSAQ M W/Mr. 1146.42 Molecular Formula C48H91N17O13S Storage -20°C Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturin
Creative Peptides [2017-10-16 14:10:18 ]
4mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any needs , pls feel free contact me .
Greatcooler Electronic Technology Co.,LTD [2017-10-16 14:09:56 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. More information please visit our website https://www creative-peptides com/product/lep-mouse-item-r0836-34638.html CAT#R0836 CAS No.258276-95-8 SequenceSCSLPQTSGLQKPES (Modif
Creative Peptides [2017-10-16 14:09:27 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We provi
Creative Peptides [2017-10-16 14:08:21 ]
Item Specifications Product Name Steel cabinet Brand Feng Long Model SC-L1 Dimension H900mm*W400mm*D900mm, per customer`s requirement Packing Volume 0.093CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office furnitur
LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD [2017-10-16 14:07:55 ]
