Health & Medical Manufacturers and Suppliers

Total 5982 products found
Liquid silicone rubber for making prosthetic limbs

Description of Liquid silicone rubber for making prosthetic limbs Liquid life casting silicone rubber is generally named two-components silicone rubber, Part A and part B. It features an exceptional fluidity and good operability. The mixing ratio is 1 1, mainly be suitable for ma

HONG KONG HONG YE TECHONOLOGY CO., LTD.      [2016-12-26 20:08:04 ]

original ANSOMONE HGH with Unique anti-counterfeiting code

(20iu/kit, 40iu/kit, 45iu/kit, 60iu/kit, 100iu/kit,160iu/kit) EP/USP standard Direct Factory Price No-worry service ( Guaranteed delivery to you door ) Original Ansomone HGH is one of the most recommended HGH supplements in body-building, anti-aging community etc for more than 20

Anhui Anke Biotechnology (Group) Co., Ltd      [2016-12-20 09:47:07 ]

Full printing custom designed natural rubber yoga mats with carrying strap

C U S T O M D E S I G N E D Y O G A M A T THIS IS THE YOGA MAT YOU ARE LOOKING FOR Eco-friendly, Durable, Biodegradable, Machine Washable Customize · Full color custom printing available · Logo/custom label printing available · ODM & OEM service available · Vector or photogra

Hangzhou Fanmao Technology Co., Ltd.      [2016-12-15 14:03:04 ]

Dextromethorphan Hydrobromide Dextromethorphan Hydrobromide

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Dextromethorphan Hydrobromide Key words Dextromethorphan Hydrobromide,Dextromethorphan Hydrobromide,Dextromethorphan Hydrobromide,Dextromethorphan Hydrobromide Dextromethorphan

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:51:57 ]

Dexamethasone

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Dexamethasone Another Name 9-alpha-fluoro-11-beta,17-alpha,21-trihydroxy-16-alpha-methylpregna-1,4-diene-3,20-dione; 9-alpha-fluoro-16-alpha-methylprednisolone; 9alpha-Fluoro-11beta,17alpha,

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:48:30 ]

Deslorelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Deslorelin Synonyms GLP-HIS-TRP-SER-TYR-D-TRP-LEU-ARG-PRO-NHET;[D-TRP6, DES-GLY10]-LH-RH ETHYLAMIDE;DESORELIN;DESLORELIN;deslorelin acetate;DESLORELIN (HUMAN);DES-GLY10,[D-TRP6]

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:43:06 ]

Epitalon

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Epitalon,10mg/vial Product Name Glycine, L-alanyl-L-a-glutamyl-L-a-aspartyl- Synonyms Epitalon;Epithalon;Glycine, L-alanyl-L-a-glutamyl-L-a-aspartyl-;L-alanyl-L-alpha-glutamyl-L-alpha-aspart

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:40:40 ]

Adipotide

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Quick Detail Adipotide Sequence CKGGRAKDC-GG-D(KLAKLAK)2 Peptide Sequence ys-Lys-Gly-Gly-Arg-Ala-Lys-Asp-Cys-Gly-Gly{D-Lys}-{D-Leu}-{D-Ala}-{D-Lys}-{D-Leu}-{D-Ala}-{D-Lys}-{D-Lys}-{D-Leu}-{D

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:28:52 ]

Eptifibatide

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Eptifibatide Sequence Mpr-Har-Gly-Asp-Trp-Pro-Cys-NH2 Cas No. 148031-34-9 Molecular Formula C35H49N11O9S2 Molecular Weight 832.4 Specific Rotation[20/D] -75.0~-95.0°(C=1,1%HAc) Amin

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:26:11 ]

Follistatin 344

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Follistatin hghsalehumanstech(at)gmail dot com 295,315,317,344 amino acids of the protein. FST(Recombinant Human Follistatin) Period in infants and children, continued growth of muscle, hard

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:20:24 ]

Triptorelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Triptorelin introductions Appearance White powder Solubility Soluble in water or 1% acetic acid at a concentration of 1mg/ml to give a clear, colorless solution Identity by HPLC The retentio

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:04:51 ]

HGH Fragment (176-191)

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Growth Hormone peptide fragment 176-191, also known as HGH Frag 176-191, is a modified form of amino acids 176-191 of the GH polypeptide. Investigators at Monash University discovered that t

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:02:01 ]

Pentadecapeptide BPC 157

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com pentadecapeptide BPC 157 Alias Booly Protection Compound 15, Pentadecapeptide, BPC 157 CAS 137525-51-0 Sequence Gly-Glu-Pro-Pro-Pro-Gly- Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val MF C62H98N16O22 M

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 15:00:49 ]

Oxytocin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Formula C43H66N12O12S2 Synonyms 3-Isoleucine-8-leucine vasopressin;Alpha-hypophamine;Atonin O;Di-sipidin;Endopituitrina;Hyphotocin;Intertocine S;Nobitocin S;Orasthin;Partocon;Perlacton;Pitoc

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:58:55 ]

Sermorelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-G

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:58:01 ]

Hexarelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Hexarelin Synonyms HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE RELEASING HEXAPEPTIDE;Examorelin;Hexareline;L-Histidyl-2-methyl

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:55:45 ]

Ipamorelin

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Ipamorelin Sequence Aib-His-D-2-Nal-D-Phe-Lys-NH2 Cas No. 170851-70-4 Purity (HPLC) 98.0% Molecular Formula C38H49N905 Molecular Weight 712.03 Single Impurity (HPLC) 0.5%max Amino Acid Compo

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:54:53 ]

Melanotan 2

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com MT-2 Product Name Melanotan II, MT- II split into vivals, MT2 supplier, Melanotan II manufacturer MT2 Another Name Melanotan II; AC-NLE-CYCLO(-BETA-ASP-HIS-D-PHE-ARG-TRP-EPSILON-LYS-NH2); Me

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:35:57 ]

CJC-1295

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com CJC-1295 Alias CJC-1295 Acetate; CJC1295(Without DAC); Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys (Mal

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:28:33 ]

CJC-1295 DAC

Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com CJC-1295 DAC (Drug Affinity Complex) Alias CJC1295(GHRH/DAC) Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Ly

Guangzhou Kafen Biotech Co.,Ltd      [2016-12-12 14:27:44 ]