Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com INCI Name Nonapeptide-1 Amino Sequence Met-Pro-D-Phe-Arg-D-Trp-Phe-Lys-Pro-Val-NH2 Functions · Prevent melanin synthesis by preventing activation of the tyrosinase. · Prevent unwanted pigm
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:45:12 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Deslorelin Synonyms GLP-HIS-TRP-SER-TYR-D-TRP-LEU-ARG-PRO-NHET;[D-TRP6, DES-GLY10]-LH-RH ETHYLAMIDE;DESORELIN;DESLORELIN;deslorelin acetate;DESLORELIN (HUMAN);DES-GLY10,[D-TRP6]
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:43:06 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Epitalon,10mg/vial Product Name Glycine, L-alanyl-L-a-glutamyl-L-a-aspartyl- Synonyms Epitalon;Epithalon;Glycine, L-alanyl-L-a-glutamyl-L-a-aspartyl-;L-alanyl-L-alpha-glutamyl-L-alpha-aspart
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:40:40 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Specifications Pharmacopoeial grade Purity 99%+ Brand Biocar Origion Hubei,China Details Price Negotiable Package Aluminum foil bags or fiber drum DeliveryTime About 7 days Product S
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:30:24 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Quick Detail Adipotide Sequence CKGGRAKDC-GG-D(KLAKLAK)2 Peptide Sequence ys-Lys-Gly-Gly-Arg-Ala-Lys-Asp-Cys-Gly-Gly{D-Lys}-{D-Leu}-{D-Ala}-{D-Lys}-{D-Leu}-{D-Ala}-{D-Lys}-{D-Lys}-{D-Leu}-{D
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:28:52 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Eptifibatide Sequence Mpr-Har-Gly-Asp-Trp-Pro-Cys-NH2 Cas No. 148031-34-9 Molecular Formula C35H49N11O9S2 Molecular Weight 832.4 Specific Rotation[20/D] -75.0~-95.0°(C=1,1%HAc) Amin
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:26:11 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Follistatin hghsalehumanstech(at)gmail dot com 295,315,317,344 amino acids of the protein. FST(Recombinant Human Follistatin) Period in infants and children, continued growth of muscle, hard
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:20:24 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Selank is Sterile filtered white lyophilized (freeze-dried) powder Selank is presented in the form of lyophilized powder; that is, a powder that has been freeze-dried. In terms of solubility
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:17:37 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com b DSIP Unit Size 2 mg/vial DSIP Unit Quantity 1 Vial DSIP Purity 99.0%min Delta sleep-inducing peptide(DSIP) Sequence r-l-Gly-Gly-Asp-Ala-Ser-Gly-Glu Specification 2mg/vial; CAS# 62568-57-
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:15:37 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Gonadorelin Acetate Sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 Cas No. 71447-49-9; 33515-09-2 Purity (HPLC) 98.0%min. Molecular Formula C59H83N17O17 Molecular Weight 1302.39 Single
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:14:31 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Egrifta(tesamorelin) Sequence H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH Cas No. 106612-94-6 Purity (HPL
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:09:58 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Triptorelin introductions Appearance White powder Solubility Soluble in water or 1% acetic acid at a concentration of 1mg/ml to give a clear, colorless solution Identity by HPLC The retentio
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:04:51 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Growth Hormone peptide fragment 176-191, also known as HGH Frag 176-191, is a modified form of amino acids 176-191 of the GH polypeptide. Investigators at Monash University discovered that t
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:02:01 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com pentadecapeptide BPC 157 Alias Booly Protection Compound 15, Pentadecapeptide, BPC 157 CAS 137525-51-0 Sequence Gly-Glu-Pro-Pro-Pro-Gly- Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val MF C62H98N16O22 M
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:00:49 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com TB-500 is a peptide fragment hormone that is primarily used in the treatment of various muscle injuries or pain caused by inflammation. There is very little official human data available for
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:59:39 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Formula C43H66N12O12S2 Synonyms 3-Isoleucine-8-leucine vasopressin;Alpha-hypophamine;Atonin O;Di-sipidin;Endopituitrina;Hyphotocin;Intertocine S;Nobitocin S;Orasthin;Partocon;Perlacton;Pitoc
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:58:55 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-G
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:58:01 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Hexarelin Synonyms HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE RELEASING HEXAPEPTIDE;Examorelin;Hexareline;L-Histidyl-2-methyl
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:55:45 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Ipamorelin Sequence Aib-His-D-2-Nal-D-Phe-Lys-NH2 Cas No. 170851-70-4 Purity (HPLC) 98.0% Molecular Formula C38H49N905 Molecular Weight 712.03 Single Impurity (HPLC) 0.5%max Amino Acid Compo
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:54:53 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com GHRP-6 (Growth hormone releasing peptide) Alias GROWTH HORMONE RELEASING PEPTIDE-6; [HIS1, LYS6]-GHRP; HIS-D-TRP-ALA-TRP-D-PHE-LYS-NH2; H-HIS-D-TRP-ALA-TRP-D-PHE-LYS-NH2 CAS 87616-84-0 Purit
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:37:48 ]