Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Follistatin hghsalehumanstech(at)gmail dot com 295,315,317,344 amino acids of the protein. FST(Recombinant Human Follistatin) Period in infants and children, continued growth of muscle, hard
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:20:24 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Selank is Sterile filtered white lyophilized (freeze-dried) powder Selank is presented in the form of lyophilized powder; that is, a powder that has been freeze-dried. In terms of solubility
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:17:37 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com b DSIP Unit Size 2 mg/vial DSIP Unit Quantity 1 Vial DSIP Purity 99.0%min Delta sleep-inducing peptide(DSIP) Sequence r-l-Gly-Gly-Asp-Ala-Ser-Gly-Glu Specification 2mg/vial; CAS# 62568-57-
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:15:37 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Gonadorelin Acetate Sequence Glp-His-Trp-Ser-Tyr-Gly-Leu-Arg-Pro-Gly-NH2 Cas No. 71447-49-9; 33515-09-2 Purity (HPLC) 98.0%min. Molecular Formula C59H83N17O17 Molecular Weight 1302.39 Single
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:14:31 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Egrifta(tesamorelin) Sequence H-HIS-ALA-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH Cas No. 106612-94-6 Purity (HPL
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:09:58 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Triptorelin introductions Appearance White powder Solubility Soluble in water or 1% acetic acid at a concentration of 1mg/ml to give a clear, colorless solution Identity by HPLC The retentio
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:04:51 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Growth Hormone peptide fragment 176-191, also known as HGH Frag 176-191, is a modified form of amino acids 176-191 of the GH polypeptide. Investigators at Monash University discovered that t
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:02:01 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com pentadecapeptide BPC 157 Alias Booly Protection Compound 15, Pentadecapeptide, BPC 157 CAS 137525-51-0 Sequence Gly-Glu-Pro-Pro-Pro-Gly- Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val MF C62H98N16O22 M
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 15:00:49 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com TB-500 is a peptide fragment hormone that is primarily used in the treatment of various muscle injuries or pain caused by inflammation. There is very little official human data available for
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:59:39 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Formula C43H66N12O12S2 Synonyms 3-Isoleucine-8-leucine vasopressin;Alpha-hypophamine;Atonin O;Di-sipidin;Endopituitrina;Hyphotocin;Intertocine S;Nobitocin S;Orasthin;Partocon;Perlacton;Pitoc
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:58:55 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Sermorelin Synonyms SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-G
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:58:01 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name Hexarelin Synonyms HIS-D-2-METHYL-TRP-D-PHE-LYS-NH2;HIS-D-2-ME-TRP-ALA-TRP-D-PHE-LYS-NH2;HEXARELIN;GROWTH HORMONE RELEASING HEXAPEPTIDE;Examorelin;Hexareline;L-Histidyl-2-methyl
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:55:45 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Ipamorelin Sequence Aib-His-D-2-Nal-D-Phe-Lys-NH2 Cas No. 170851-70-4 Purity (HPLC) 98.0% Molecular Formula C38H49N905 Molecular Weight 712.03 Single Impurity (HPLC) 0.5%max Amino Acid Compo
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:54:53 ]
Advantage 1.High invert efficiency and rapid start; 2.Great physical performance; 3.Low self-discharge rate; 4.Reasonable price; 5.Professional Li-battery customization. No Item Condition Specification 1 /capability /Capacity 14Ah /Minimum Capacity 14.7Ah 2 /Rating Voltage 36±0.
Shenzhen Believe Technology Co.,Ltd [2016-12-12 14:42:10 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com GHRP-6 (Growth hormone releasing peptide) Alias GROWTH HORMONE RELEASING PEPTIDE-6; [HIS1, LYS6]-GHRP; HIS-D-TRP-ALA-TRP-D-PHE-LYS-NH2; H-HIS-D-TRP-ALA-TRP-D-PHE-LYS-NH2 CAS 87616-84-0 Purit
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:37:48 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Quick Detail Product Name GHRP-2 Growth Hormone Releasing Peptide 2 GHRP Sequence H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Molecular formula C45H55N9O6 Molar Mass 817.9 CAS number 158861-67-7 P
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:36:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com MT-2 Product Name Melanotan II, MT- II split into vivals, MT2 supplier, Melanotan II manufacturer MT2 Another Name Melanotan II; AC-NLE-CYCLO(-BETA-ASP-HIS-D-PHE-ARG-TRP-EPSILON-LYS-NH2); Me
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:35:57 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com Product Name PT-141 Synonyms BREMELANOTIDE;Brmelanotice;Ac-Nle-cyclo(-Asp-His-D-Phe-Arg-Trp-Lys)-OH;Bremelanotide, PT141,PT-141;BREMELANOTIDE PT141;N-Acetyl-L-norleucyl-L-alpha-aspartyl-L-hi
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:30:16 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com CJC-1295 Alias CJC-1295 Acetate; CJC1295(Without DAC); Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys (Mal
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:28:33 ]
Email albert@kafenbio com Skype kafenbiotech WhatsApp +8618011892373 www kafenbiotech com CJC-1295 DAC (Drug Affinity Complex) Alias CJC1295(GHRH/DAC) Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Ly
Guangzhou Kafen Biotech Co.,Ltd [2016-12-12 14:27:44 ]