RFID dual protocol electronic tag RF card high frequency ultra high frequency combo white card 915Mhz Aikeyi Technology WeChat aky_01,Skype 13423626252,QQ 2880179620,WhatsApp 15011978320) Frequency CPU & 915MHz dual frequency 1. CPU 2. 915MHz EPC Class1 Gen2 Finished size 85.6mmX
Guangzhou AIKEYI Smart Card Technology Co.,Ltd. [2017-10-16 15:42:58 ]
Custom Ntag213 / 215 White Card, Game Card Design,14443A Agreement White Standard Original NTAG215 Chip NFC Electronic Label NFC Sticker Label Aikeyi Technology WeChat aky_01,Skype 13423626252,QQ 2880179620,WhatsApp 15011978320) Diameter 25mm,or customized Chip Model NTAG 215 Ope
Guangzhou AIKEYI Smart Card Technology Co.,Ltd. [2017-10-16 15:42:14 ]
H3 electronic label international standard white card Aikeyi Technology WeChat aky_01,Skype 13423626252,QQ 2880179620,WhatsApp 15011978320) About H3 electronic tags project description Remarks Manufacturer / chip Alien/Higgs3 Base material PET Antenna process mode Aluminum Etchin
Guangzhou AIKEYI Smart Card Technology Co.,Ltd. [2017-10-16 15:40:55 ]
Email ....... kathy@wh-wanli com Skype ........rcwanli@outlook com We provide and export high quality and purity research chemicals in large and small quantities ... our products is as below Our products are of high purity (above 99%).( Please email to kathy@wh-wanli com) 4MEC,BK
WUHAN Manley Biological Co.,ltd [2017-10-16 14:54:13 ]
Luoyang Iron King Trading Co., Ltd. Is a office furniture factory was established in 2 0 1 1. It is a professional metal furniture factory which is located in Luoyang, China. Iron King factory covers over 5, 3 0 0 square meters. Iron King group owns more than 6 0 skillful workers
LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD [2017-10-16 14:42:58 ]
Features 1 HD 960P(1280*960), 1.3 MP, H.264. 2 Night Vision Adopt new starlight level sensor, with shimmer night visioin is full color, IR distance 20M. 3 Lens 4mm, F16 Starlight level Lens with better ngith vision. 4 microSD Card Supports upto 64GB microSD card for recording and
Shenzhen Sricctv Technology Co.Ltd. [2017-10-16 14:26:22 ]
Creative Peptides offers HLA-A_24_02 HBV pol tetramer-KYTSFPWLL-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-hbv-pol-tetramer-kytsfpwll-apc-labeled-item-cpm-1-0033-33873.html for more informa
Creative Peptides [2017-10-16 14:25:35 ]
Creative Peptides offers H-2Db human gp100 tetramer-KVPRNQDWL-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/h-2db-human-gp100-tetramer-kvprnqdwl-apc-labeled-item-cpm-1-0034-33874.html for more infor
Creative Peptides [2017-10-16 14:24:26 ]
Creative Peptides offers HLA-A_01_01 CMV pp50 tetramer-VTEHDTLLY-APC labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-cmv-pp50-tetramer-vtehdtlly-apc-labeled-item-cpm-1-0035-33875.html for more infor
Creative Peptides [2017-10-16 14:23:37 ]
Creative Peptides offers HLA-A_24_02 hTERT tetramer-VYGFVRACL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-htert-tetramer-vygfvracl-pe-labeled-item-cpm-1-0036-33876.html for more information.
Creative Peptides [2017-10-16 14:23:10 ]
Creative Peptides offers HLA-E_01_03 HLA-A leader3-11 tetramer-VMAPRTLVL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-e-hla-a-leader3-tetramer-vmaprtlvl-pe-labeled-item-cpm-1-0037-33877.html for
Creative Peptides [2017-10-16 14:21:07 ]
Creative Peptides offers HLA-A_11_01 EBV EBNA3B 416-424 tetramer-IVTDFSVIK-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-ebv-ebna3b-tetramer-ivtdfsvik-pe-labeled-item-cpm-1-0038-33878.html for
Creative Peptides [2017-10-16 14:20:40 ]
Creative Peptides offers H-2Ld HBsAg tetramer-IPQSLDSWWTSL-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/h-2ld-hbsag-tetramer-ipqsldswwtsl-pe-labeled-item-cpm-1-0039-33879.html for more information.
Creative Peptides [2017-10-16 14:18:15 ]
Creative Peptides offers HLA-A_11_01 CMV pp65 tetramer-ATVQGQNLK-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-cmv-pp65-tetramer-atvqgqnlk-pe-labeled-item-cpm-1-0040-33880.html for more informa
Creative Peptides [2017-10-16 14:16:28 ]
Product Name steel almirah designs metal clothes locker cabinet Brand Feng Long Model SL-A2-2 Dimension H1850mm*W380mm*D450mm, per customer`s requirement Packing Volume 0.05CBM Quantity /20GP 560 PCS Quantity /40HQ 1360 PCS Steel Thickness 0.6mm as regular, 0.5-1.2mm available Fu
LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD [2017-10-16 14:15:59 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. Sequence
Creative Peptides [2017-10-16 14:14:40 ]
We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Synonyms/Alias GS peptide-2 CAS No. 851366-97-7 Sequence YRRAAVPPSPSLSRHSSPHQSEDEEE (Modifications Ser-21 = OPO3H
Creative Peptides [2017-10-16 14:13:43 ]
80mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any interest pls feel free contact me .
Greatcooler Electronic Technology Co.,LTD [2017-10-16 14:12:47 ]
Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We provi
Creative Peptides [2017-10-16 14:12:46 ]
CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on
Creative Peptides [2017-10-16 14:12:09 ]
