Please input queries on the search bar

HLA-A_11_01 CMV pp65 tetramer-ATVQGQNLK-PE labeled

Creative Peptides offers HLA-A_11_01 CMV pp65 tetramer-ATVQGQNLK-PE labeled which can be used for direct detection of antigen specific T cells. Visit https://www creative-peptides com/product/hla-a-cmv-pp65-tetramer-atvqgqnlk-pe-labeled-item-cpm-1-0040-33880.html for more informa

Creative Peptides      [2017-10-16 14:16:28 ]

steel almirah designs metal clothes locker cabinet

Product Name steel almirah designs metal clothes locker cabinet Brand Feng Long Model SL-A2-2 Dimension H1850mm*W380mm*D450mm, per customer`s requirement Packing Volume 0.05CBM Quantity /20GP 560 PCS Quantity /40HQ 1360 PCS Steel Thickness 0.6mm as regular, 0.5-1.2mm available Fu

LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD      [2017-10-16 14:15:59 ]

Lyn peptide inhibitor

We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. Sequence

Creative Peptides      [2017-10-16 14:14:40 ]

Phospho-Glycogen Synthase Peptide-2 (substrate)

We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Synonyms/Alias GS peptide-2 CAS No. 851366-97-7 Sequence YRRAAVPPSPSLSRHSSPHQSEDEEE (Modifications Ser-21 = OPO3H

Creative Peptides      [2017-10-16 14:13:43 ]

80mm fan metal guard

80mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any interest pls feel free contact me .

Greatcooler Electronic Technology Co.,LTD      [2017-10-16 14:12:47 ]

Motilin (human, porcine)

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We provi

Creative Peptides      [2017-10-16 14:12:46 ]

GLP-2 (rat)

CAS No. 195262-56-7 Sequence HADGSFSDEMNTILDNLATRDFINWLIQTKITD M W/Mr. 3796.17 Molecular Formula C166H256N44O56S Application Endogenous peptide identified as an intestinal epithelium-specific growth factor; stimulates cell proliferation and inhibits apoptosis. Diverse effects on

Creative Peptides      [2017-10-16 14:12:09 ]

3 drawers Aluminum alloy clasp hands steel file cabinet

Product Name Filing cabinet Brand Feng Long Model FC-N3-3 Dimension H1031mm*W452mm*D620mm, per customer`s requirement Packing Volume 0.069CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office furniture Port Qingdao,S

LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD      [2017-10-16 14:11:15 ]

pep4c

Sequence KRMKVAKSAQ M W/Mr. 1146.42 Molecular Formula C48H91N17O13S Storage -20°C Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturin

Creative Peptides      [2017-10-16 14:10:18 ]

4mm fan metal guard

4mm fan metal guard Place of Origin China (Mainland) port shenzhen Brand Name greatcooler Packaging & Delivery Packaging Details standard package Delivery Detail Shipped in 15-25 days after payment. If you have any needs , pls feel free contact me .

Greatcooler Electronic Technology Co.,LTD      [2017-10-16 14:09:56 ]

LEP (116-130) (mouse)

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. More information please visit our website https://www creative-peptides com/product/lep-mouse-item-r0836-34638.html CAT#R0836 CAS No.258276-95-8 SequenceSCSLPQTSGLQKPES (Modif

Creative Peptides      [2017-10-16 14:09:27 ]

pep2-SVKE

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. We provi

Creative Peptides      [2017-10-16 14:08:21 ]

2 doors hang the garment bag integrated ark metal steel cabinet

Item Specifications Product Name Steel cabinet Brand Feng Long Model SC-L1 Dimension H900mm*W400mm*D900mm, per customer`s requirement Packing Volume 0.093CBM Place of origin HENAN,LUOYANG Colour custom Steel Thickness 0.6mm as regular, 0.5-1.2mm available Function Office furnitur

LUOYANG FENGLONG OFFICE FURNITURE CO.,LTD      [2017-10-16 14:07:55 ]

Pep1-TGL

Sequence SSGMPLGATGL M W/Mr. 990.14 Molecular Formula C41H71N11O15S Storage -20°C Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturin

Creative Peptides      [2017-10-16 14:07:11 ]

Pep1-AGL

We provide Pep1-AGL. More information please visit our website https://www creative-peptides com/product/pep1-agl-item-r0833-34635.html CAT#R0833 SequenceSSGMPLGAAGL M W/Mr.960.11 Molecular FormulaC40H69N11O14S Storage-20°C Creative Peptides is specialized in the process develop

Creative Peptides      [2017-10-16 14:05:57 ]

Retrobradykinin

We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAT# R0832 CAS No. 5991-13-9 Sequence RFPSFGPPR M W/Mr. 1060.22 Molecular Formula C50H73N15O11 Storage -20°C We

Creative Peptides      [2017-10-16 14:04:11 ]

Bombinakinin-GAP

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAT#R083

Creative Peptides      [2017-10-16 14:03:19 ]

apoE(133-149)

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAS No.5

Creative Peptides      [2017-10-16 14:02:26 ]

GR 231118

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. CAT#R082

Creative Peptides      [2017-10-16 14:01:32 ]

RAGE antagonist peptide

Creative Peptides is specialized in the process development and the manufacturing of bioactive peptides. We are dedicated to offering custom peptide synthesis, process development, GMP manufacturing as well as catalog products for customers in industry and research area. Visit ht

Creative Peptides      [2017-10-16 14:00:22 ]